F246837

General Info

Members Datasets Scaffolds Average Seq Length
165 107 158 294

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0278157|Ga0466959_0278157_63_1055
Length 330
Sequence VTDDRRGLGFGIGAYLLWGLFPLYFPLLEPAGTIEILAQRMAWSLVVTVIILAATGGFRGVRAVIADRRQLAYLSLAAVLISVNWGVYIYAVNSGHVVEASLGYFINPLFTILLGVAVLRERLRAGQWVAVAIGAVAXXVIAVDYGRLPWIALTLAVSFGLYGFCKKRASVGAADSMAIETGVLFLPACIAISVLGAHGQLVFGTRPATSVLIAGSGLITIIPLLMFAGAATRLPLTVLGLVQFLTPVLQFAVGVGIRHEKLPGTEWIGFGLVWLALIVLTVDGLRAGRRRPADPVSLGPRESPDSQDPAEVPVDFGASASTGEAAPGAR

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
3 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
4 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
5 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
6 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
7 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
8 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
9 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
10 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
11 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
12 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
13 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
33 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
36 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
37 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
38 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
40 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
42 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
43 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
44 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
54 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
55 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
56 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
57 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
58 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
59 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
60 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
61 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
62 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
63 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
64 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
65 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
66 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
67 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
68 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
69 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
70 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
71 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
72 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
73 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
74 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
75 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
76 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
77 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
78 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
79 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
80 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
81 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
82 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
83 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
84 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
85 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
86 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
87 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
88 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
89 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
90 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
91 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
92 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
93 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
94 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
95 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
96 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
103 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
105 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
106 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
107 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.76
Metatranscriptomes 0
Isolates 4.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.85
Nodule 1.21
Rhizoplane 10.3
Rhizosphere 62.42
Stem 0
Stem Tuber 0
Unclassified 21.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000791 3300002704 Bacteria 5091
2 JGI25155J39150_1001811 3300002704 Bacteria 1299
3 JGI25156J39149_1000482 3300002705 Bacteria 23933
4 JGI25156J39149_1015012 3300002705 Bacteria 1570
5 JGI25162J39368_1002709 3300002737 Bacteria 6411
6 JGI25154J39366_1000214 3300002738 Bacteria 40081
7 JGI25154J39366_1001619 3300002738 Bacteria 7621
8 JGI25157J39369_1000910 3300002741 Bacteria 14148
9 Ga0055532_1000074 3300003758 Bacteria 125513
10 Ga0070658_10204716 3300005327 Bacteria 1666
11 Ga0070676_10223808 3300005328 Bacteria 1244
12 Ga0070683_100348732 3300005329 Bacteria 1410
13 Ga0070670_100011489 3300005331 Bacteria 7575
14 Ga0070673_100434352 3300005364 Bacteria 1179
15 Ga0070714_100000011 3300005435 Bacteria 231268
16 Ga0070706_100075504 3300005467 Bacteria 3119
17 Ga0068855_100385231 3300005563 Bacteria 1539
18 Ga0068855_100766666 3300005563 Bacteria 1027
19 Ga0068856_100047899 3300005614 Bacteria 4211
20 Ga0070702_100376479 3300005615 Bacteria 1008
21 Ga0081455_10013281 3300005937 Bacteria 8156
22 Ga0081540_1023613 3300005983 Bacteria 3591
23 Ga0105251_10076433 3300009011 Bacteria 1554
24 Ga0105240_10000849 3300009093 Bacteria 55063
25 Ga0105240_10019618 3300009093 Bacteria 9031
26 Ga0105240_10065998 3300009093 Bacteria 4491
27 Ga0105237_10129095 3300009545 Bacteria 2522
28 Ga0105237_10235920 3300009545 Bacteria 1830
29 Ga0105237_10482551 3300009545 Bacteria 1246
30 Ga0105238_10100350 3300009551 Bacteria 2878
31 Ga0157370_10175781 3300013104 Bacteria 1990
32 Ga0157369_10053926 3300013105 Bacteria 4342
33 Ga0157374_10602828 3300013296 Bacteria 1108
34 Ga0157378_10030251 3300013297 Bacteria 4785
35 Ga0157372_10000069 3300013307 Bacteria 110621
36 Ga0157375_10783036 3300013308 Bacteria 1103
37 Ga0182008_10055243 3300014497 Bacteria 1964
38 Ga0209435_100055 3300025206 Bacteria 86115
39 Ga0209435_100183 3300025206 Bacteria 18784
40 Ga0209147_100097 3300025229 Bacteria 164034
41 Ga0209437_100404 3300025233 Bacteria 39946
42 Ga0209258_100192 3300025242 Bacteria 125565
43 Ga0209646_1000103 3300025246 Bacteria 164034
44 Ga0209646_1000317 3300025246 Bacteria 37175
45 Ga0209026_1000134 3300025250 Bacteria 117098
46 Ga0209026_1003400 3300025250 Bacteria 5247
47 Ga0209759_1000091 3300025256 Bacteria 164034
48 Ga0209759_1000545 3300025256 Bacteria 39039
49 Ga0209455_1001368 3300025272 Bacteria 11154
50 Ga0207647_10076222 3300025904 Bacteria 2017
51 Ga0207684_10287143 3300025910 Bacteria 1419
52 Ga0207695_10003180 3300025913 Bacteria 23401
53 Ga0207695_10038234 3300025913 Bacteria 5169
54 Ga0207695_10078711 3300025913 Bacteria 3344
55 Ga0207695_10147664 3300025913 Bacteria 2293
56 Ga0207694_10144919 3300025924 Bacteria 1911
57 Ga0207667_10001141 3300025949 Bacteria 33402
58 Ga0207667_10178516 3300025949 Bacteria 2181
59 Ga0207639_10322242 3300026041 Bacteria 1372
60 Ga0207678_10191295 3300026067 Bacteria 1749
61 Ga0207702_10006059 3300026078 Bacteria 10492
62 Ga0207702_10057811 3300026078 Bacteria 3298
63 Ga0265338_10012803 3300028800 Bacteria 9536
64 Ga0395898_0256593 3300037466 Bacteria 1667
65 Ga0395901_0247777 3300038443 Bacteria 1857
66 Ga0451787_227456 3300041441 Bacteria 1706
67 Ga0451791_1171718 3300041451 Bacteria 5339
68 Ga0451793_0151093 3300041452 Bacteria 9419
69 Ga0451797_1076961 3300041453 Bacteria 3904
70 Ga0451839_0428108 3300041496 Bacteria 2661
71 Ga0451853_0087162 3300041512 Bacteria 1727
72 Ga0466972_0017161 3300044658 Bacteria 3621
73 Ga0466972_0112005 3300044658 Bacteria 1289
74 Ga0466965_0141605 3300044683 Bacteria 1252
75 Ga0466966_0091062 3300044684 Bacteria 1893
76 Ga0466961_0025502 3300044693 Bacteria 3801
77 Ga0466961_0032154 3300044693 Bacteria 3371
78 Ga0466961_0128323 3300044693 Bacteria 1590
79 Ga0466963_0003383 3300044694 Bacteria 9114
80 Ga0466963_0004939 3300044694 Bacteria 7774
81 Ga0466963_0008280 3300044694 Bacteria 6230
82 Ga0466963_0035788 3300044694 Bacteria 3234
83 Ga0466963_0058973 3300044694 Bacteria 2561
84 Ga0466963_0161472 3300044694 Bacteria 1559
85 Ga0466964_0094473 3300044706 Bacteria 1307
86 Ga0466971_0028499 3300044719 Bacteria 2498
87 Ga0466971_0035045 3300044719 Bacteria 2250
88 Ga0466971_0098518 3300044719 Bacteria 1342
89 Ga0466968_0042266 3300044735 Bacteria 1927
90 Ga0466970_0008497 3300044765 Bacteria 5169
91 Ga0466970_0023785 3300044765 Bacteria 3202
92 Ga0466970_0058346 3300044765 Bacteria 2066
93 Ga0466957_0009292 3300044842 Bacteria 5609
94 Ga0466957_0013980 3300044842 Bacteria 4668
95 Ga0466957_0053027 3300044842 Bacteria 2471
96 Ga0466957_0098249 3300044842 Bacteria 1842
97 Ga0466960_0159689 3300044901 Bacteria 1209
98 Ga0466959_0004652 3300045049 Bacteria 9235
99 Ga0466959_0072339 3300045049 Bacteria 2496
100 Ga0466959_0151791 3300045049 Bacteria 1633
101 Ga0466959_0165486 3300045049 Bacteria 1553
102 Ga0466959_0278157 3300045049 Bacteria 1149
103 Ga0466958_0007972 3300045836 Bacteria 5854
104 Ga0466958_0013909 3300045836 Bacteria 4590
105 Ga0466958_0014342 3300045836 Bacteria 4525
106 Ga0466958_0050646 3300045836 Bacteria 2514
107 Ga0466958_0091067 3300045836 Bacteria 1887
108 Ga0466958_0263650 3300045836 Bacteria 1103
109 Ga0466958_0264019 3300045836 Bacteria 1102
110 Ga0466967_0000262 3300045976 Bacteria 23087
111 Ga0466967_0086056 3300045976 Bacteria 2847
112 Ga0466967_0100087 3300045976 Bacteria 2648
113 Ga0466967_0157148 3300045976 Bacteria 2131
114 Ga0466967_0209374 3300045976 Bacteria 1849
115 Ga0495654_0119269 3300046530 Bacteria 1196
116 Ga0495625_0001090 3300046660 Bacteria 35274
117 Ga0496102_0405006 3300048905 Bacteria 1282
118 Ga0496103_0081889 3300048906 Bacteria 2031
119 Ga0496104_0117874 3300048907 Bacteria 2548
120 Ga0496104_0253710 3300048907 Bacteria 1672
121 Ga0496108_0029435 3300048911 Bacteria 4548
122 Ga0496109_0003025 3300048912 Bacteria 14029
123 Ga0496109_0099967 3300048912 Bacteria 2691
124 Ga0496109_0492419 3300048912 Bacteria 1157
125 Ga0496110_0015300 3300048913 Bacteria 6382
126 Ga0496111_0507711 3300048914 Bacteria 887
127 Ga0496112_0127944 3300048915 Bacteria 2511
128 Ga0496113_0011175 3300048916 Bacteria 5976
129 Ga0496113_0018757 3300048916 Bacteria 4825
130 Ga0496116_0013950 3300048919 Bacteria 6439
131 Ga0496118_0198302 3300048921 Bacteria 1192
132 Ga0496119_0000449 3300048922 Bacteria 56334
133 Ga0496120_0053285 3300048923 Bacteria 2299
134 Ga0496121_0016331 3300048924 Bacteria 7671
135 Ga0496121_0047070 3300048924 Bacteria 3683
136 Ga0496121_0105018 3300048924 Bacteria 2168
137 Ga0496121_0325933 3300048924 Bacteria 1032
138 Ga0496122_0001643 3300048925 Bacteria 34708
139 Ga0496123_0000755 3300048926 Bacteria 52292
140 Ga0496125_0000773 3300048928 Bacteria 52257
141 Ga0496125_0205522 3300048928 Bacteria 1284
142 Ga0496126_0000075 3300048929 Bacteria 235121
143 Ga0496126_0120324 3300048929 Bacteria 2278
144 Ga0501032_0004298 3300049569 Bacteria 10756
145 Ga0501034_0040890 3300049571 Bacteria 4691
146 Ga0501036_0033706 3300049572 Bacteria 4331
147 Ga0501037_0072381 3300049573 Bacteria 2507
148 Ga0501038_0052119 3300049574 Bacteria 3528
149 Ga0501048_0000711 3300049582 Bacteria 24335
150 Ga0501081_0216187 3300049743 Bacteria 1393
151 Ga0501035_0127672 3300049822 Bacteria 2219
152 Ga0501035_0275076 3300049822 Bacteria 1424
153 Ga0501044_0020010 3300049823 Bacteria 7147
154 Ga0501044_0043498 3300049823 Bacteria 4665
155 Ga0500618_004227 3300053125 Bacteria 4661
156 Ga0500568_0001966 3300053139 Bacteria 12563
157 Ga0466962_0005165 3300061719 Bacteria 6281
158 Ga0466962_0017986 3300061719 Bacteria 3401

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045836 Ga0466958_0263650 Ga0466958_0263650_10_768 218
2 3300049569 Ga0501032_0004298 Ga0501032_0004298_763_1686 245
3 3300049571 Ga0501034_0040890 Ga0501034_0040890_1024_1947 245
4 3300049572 Ga0501036_0033706 Ga0501036_0033706_1740_2663 245
5 3300049573 Ga0501037_0072381 Ga0501037_0072381_1016_1939 245
6 3300049574 Ga0501038_0052119 Ga0501038_0052119_1234_2157 245
7 3300049582 Ga0501048_0000711 Ga0501048_0000711_11713_12636 245
8 3300049822 Ga0501035_0127672 Ga0501035_0127672_458_1381 245
9 3300049823 Ga0501044_0020010 Ga0501044_0020010_1844_2767 245
10 3300048921 Ga0496118_0198302 Ga0496118_0198302_414_1181 246
11 3300048914 Ga0496111_0507711 Ga0496111_0507711_32_841 248
12 3300009545 Ga0105237_10129095 Ga0105237_101290952 250
13 3300005328 Ga0070676_10223808 Ga0070676_102238082 253
14 3300005364 Ga0070673_100434352 Ga0070673_1004343522 253
15 3300025913 Ga0207695_10078711 Ga0207695_100787113 253
16 3300044694 Ga0466963_0004939 Ga0466963_0004939_1919_2821 258
17 3300048906 Ga0496103_0081889 Ga0496103_0081889_470_1384 260
18 3300005563 Ga0068855_100385231 Ga0068855_1003852312 261
19 3300025913 Ga0207695_10147664 Ga0207695_101476642 261
20 3300009093 Ga0105240_10065998 Ga0105240_100659983 262
21 3300013307 Ga0157372_10000069 Ga0157372_1000006923 262
22 3300013105 Ga0157369_10053926 Ga0157369_100539265 263
23 3300048916 Ga0496113_0011175 Ga0496113_0011175_3983_4927 263
24 3300049822 Ga0501035_0275076 Ga0501035_0275076_247_1170 264
25 3300049823 Ga0501044_0043498 Ga0501044_0043498_280_1203 264
26 3300044658 Ga0466972_0112005 Ga0466972_0112005_183_1109 265
27 3300044683 Ga0466965_0141605 Ga0466965_0141605_164_1090 265
28 3300044694 Ga0466963_0035788 Ga0466963_0035788_831_1757 265
29 3300044719 Ga0466971_0028499 Ga0466971_0028499_588_1514 265
30 3300044735 Ga0466968_0042266 Ga0466968_0042266_88_1014 265
31 3300044765 Ga0466970_0008497 Ga0466970_0008497_372_1298 265
32 3300044842 Ga0466957_0053027 Ga0466957_0053027_257_1183 265
33 3300044901 Ga0466960_0159689 Ga0466960_0159689_228_1154 265
34 3300045836 Ga0466958_0013909 Ga0466958_0013909_3195_4121 265
35 3300048929 Ga0496126_0120324 Ga0496126_0120324_233_1156 266
36 3300013104 Ga0157370_10175781 Ga0157370_101757812 269
37 3300014497 Ga0182008_10055243 Ga0182008_100552434 271
38 3300005983 Ga0081540_1023613 Ga0081540_10236131 273
39 3300048905 Ga0496102_0405006 Ga0496102_0405006_111_1037 273
40 3300048907 Ga0496104_0117874 Ga0496104_0117874_630_1556 273
41 3300048911 Ga0496108_0029435 Ga0496108_0029435_2165_3091 273
42 3300048912 Ga0496109_0003025 Ga0496109_0003025_4319_5245 273
43 3300048913 Ga0496110_0015300 Ga0496110_0015300_2635_3561 273
44 3300048915 Ga0496112_0127944 Ga0496112_0127944_562_1488 273
45 3300048916 Ga0496113_0018757 Ga0496113_0018757_1419_2345 273
46 3300002704 JGI25155J39150_1001811 JGI25155J39150_10018111 276
47 3300002705 JGI25156J39149_1015012 JGI25156J39149_10150121 276
48 3300002738 JGI25154J39366_1001619 JGI25154J39366_10016191 276
49 3300025206 Ga0209435_100183 Ga0209435_1001837 276
50 3300025246 Ga0209646_1000317 Ga0209646_100031733 276
51 3300025250 Ga0209026_1003400 Ga0209026_10034004 276
52 3300025256 Ga0209759_1000545 Ga0209759_100054530 276
53 3300044658 Ga0466972_0017161 Ga0466972_0017161_1488_2417 276
54 iso_pu_bacteria 2511231003 2511250556 279
55 iso_pu_bacteria 2548876994 2550694146 279
56 iso_pu_bacteria 2818991445 2819595364 279
57 iso_pu_bacteria 2884811622 2884813369 279
58 iso_pu_bacteria 2884836552 2884839315 279
59 iso_pu_bacteria 2884852848 2884856875 279
60 iso_pu_bacteria 2896154374 2896158221 279
61 3300005563 Ga0068855_100766666 Ga0068855_1007666661 281
62 3300005615 Ga0070702_100376479 Ga0070702_1003764791 281
63 3300013308 Ga0157375_10783036 Ga0157375_107830361 281
64 3300041441 Ga0451787_227456 Ga0451787_227456_365_1285 281
65 3300041451 Ga0451791_1171718 Ga0451791_1171718_3353_4273 281
66 3300041452 Ga0451793_0151093 Ga0451793_0151093_6354_7274 281
67 3300041453 Ga0451797_1076961 Ga0451797_1076961_2872_3792 281
68 3300041496 Ga0451839_0428108 Ga0451839_0428108_271_1191 281
69 3300041512 Ga0451853_0087162 Ga0451853_0087162_313_1233 281
70 3300044693 Ga0466961_0128323 Ga0466961_0128323_64_972 281
71 3300044694 Ga0466963_0058973 Ga0466963_0058973_241_1152 281
72 3300045049 Ga0466959_0072339 Ga0466959_0072339_813_1724 281
73 3300045049 Ga0466959_0151791 Ga0466959_0151791_339_1250 281
74 3300045049 Ga0466959_0165486 Ga0466959_0165486_311_1231 281
75 3300048912 Ga0496109_0492419 Ga0496109_0492419_114_1034 281
76 3300053125 Ga0500618_004227 Ga0500618_004227_2749_3621 281
77 3300005467 Ga0070706_100075504 Ga0070706_1000755042 282
78 3300009545 Ga0105237_10235920 Ga0105237_102359202 282
79 3300025910 Ga0207684_10287143 Ga0207684_102871432 282
80 3300026041 Ga0207639_10322242 Ga0207639_103222422 282
81 3300026078 Ga0207702_10057811 Ga0207702_100578113 282
82 3300044684 Ga0466966_0091062 Ga0466966_0091062_242_1162 282
83 3300044693 Ga0466961_0025502 Ga0466961_0025502_1005_1946 282
84 3300044693 Ga0466961_0032154 Ga0466961_0032154_519_1439 282
85 3300044694 Ga0466963_0003383 Ga0466963_0003383_1810_2727 282
86 3300044694 Ga0466963_0008280 Ga0466963_0008280_2357_3268 282
87 3300044694 Ga0466963_0161472 Ga0466963_0161472_226_1152 282
88 3300044706 Ga0466964_0094473 Ga0466964_0094473_256_1167 282
89 3300044719 Ga0466971_0035045 Ga0466971_0035045_1070_1987 282
90 3300044719 Ga0466971_0098518 Ga0466971_0098518_306_1217 282
91 3300044765 Ga0466970_0023785 Ga0466970_0023785_1497_2438 282
92 3300044765 Ga0466970_0058346 Ga0466970_0058346_394_1317 282
93 3300044842 Ga0466957_0009292 Ga0466957_0009292_1174_2091 282
94 3300044842 Ga0466957_0013980 Ga0466957_0013980_760_1671 282
95 3300044842 Ga0466957_0098249 Ga0466957_0098249_719_1660 282
96 3300045049 Ga0466959_0004652 Ga0466959_0004652_562_1503 282
97 3300045049 Ga0466959_0278157 Ga0466959_0278157_63_1055 282
98 3300045836 Ga0466958_0007972 Ga0466958_0007972_731_1648 282
99 3300045836 Ga0466958_0014342 Ga0466958_0014342_504_1415 282
100 3300045836 Ga0466958_0050646 Ga0466958_0050646_1563_2501 282
101 3300045836 Ga0466958_0091067 Ga0466958_0091067_183_1124 282
102 3300045836 Ga0466958_0264019 Ga0466958_0264019_64_987 282
103 3300045976 Ga0466967_0000262 Ga0466967_0000262_21512_22423 282
104 3300045976 Ga0466967_0086056 Ga0466967_0086056_1723_2646 282
105 3300045976 Ga0466967_0100087 Ga0466967_0100087_1705_2616 282
106 3300045976 Ga0466967_0157148 Ga0466967_0157148_75_989 282
107 3300045976 Ga0466967_0209374 Ga0466967_0209374_435_1382 282
108 3300048912 Ga0496109_0099967 Ga0496109_0099967_876_1796 282
109 3300048922 Ga0496119_0000449 Ga0496119_0000449_36666_37589 282
110 3300048923 Ga0496120_0053285 Ga0496120_0053285_366_1289 282
111 3300048924 Ga0496121_0016331 Ga0496121_0016331_2001_2948 282
112 3300048929 Ga0496126_0000075 Ga0496126_0000075_148123_149067 282
113 3300061719 Ga0466962_0005165 Ga0466962_0005165_2918_3829 282
114 3300061719 Ga0466962_0017986 Ga0466962_0017986_1480_2397 282
115 3300002704 JGI25155J39150_1000791 JGI25155J39150_10007915 283
116 3300002705 JGI25156J39149_1000482 JGI25156J39149_10004825 283
117 3300002737 JGI25162J39368_1002709 JGI25162J39368_10027093 283
118 3300002738 JGI25154J39366_1000214 JGI25154J39366_100021434 283
119 3300002741 JGI25157J39369_1000910 JGI25157J39369_10009107 283
120 3300003758 Ga0055532_1000074 Ga0055532_100007476 283
121 3300005327 Ga0070658_10204716 Ga0070658_102047161 283
122 3300005329 Ga0070683_100348732 Ga0070683_1003487322 283
123 3300005331 Ga0070670_100011489 Ga0070670_1000114895 283
124 3300005435 Ga0070714_100000011 Ga0070714_10000001152 283
125 3300005614 Ga0068856_100047899 Ga0068856_1000478995 283
126 3300005937 Ga0081455_10013281 Ga0081455_100132816 283
127 3300009011 Ga0105251_10076433 Ga0105251_100764332 283
128 3300009093 Ga0105240_10000849 Ga0105240_1000084933 283
129 3300009093 Ga0105240_10019618 Ga0105240_100196185 283
130 3300009545 Ga0105237_10482551 Ga0105237_104825512 283
131 3300009551 Ga0105238_10100350 Ga0105238_101003502 283
132 3300013296 Ga0157374_10602828 Ga0157374_106028282 283
133 3300013297 Ga0157378_10030251 Ga0157378_100302513 283
134 3300025206 Ga0209435_100055 Ga0209435_10005575 283
135 3300025229 Ga0209147_100097 Ga0209147_100097109 283
136 3300025233 Ga0209437_100404 Ga0209437_10040416 283
137 3300025242 Ga0209258_100192 Ga0209258_10019275 283
138 3300025246 Ga0209646_1000103 Ga0209646_1000103109 283
139 3300025250 Ga0209026_1000134 Ga0209026_100013475 283
140 3300025256 Ga0209759_1000091 Ga0209759_1000091109 283
141 3300025272 Ga0209455_1001368 Ga0209455_10013683 283
142 3300025904 Ga0207647_10076222 Ga0207647_100762222 283
143 3300025913 Ga0207695_10003180 Ga0207695_100031805 283
144 3300025913 Ga0207695_10038234 Ga0207695_100382345 283
145 3300025924 Ga0207694_10144919 Ga0207694_101449192 283
146 3300025949 Ga0207667_10001141 Ga0207667_100011419 283
147 3300025949 Ga0207667_10178516 Ga0207667_101785162 283
148 3300026067 Ga0207678_10191295 Ga0207678_101912952 283
149 3300026078 Ga0207702_10006059 Ga0207702_100060599 283
150 3300028800 Ga0265338_10012803 Ga0265338_100128036 283
151 3300037466 Ga0395898_0256593 Ga0395898_0256593_357_1289 283
152 3300038443 Ga0395901_0247777 Ga0395901_0247777_834_1766 283
153 3300046530 Ga0495654_0119269 Ga0495654_0119269_228_1106 283
154 3300046660 Ga0495625_0001090 Ga0495625_0001090_33193_34071 283
155 3300048907 Ga0496104_0253710 Ga0496104_0253710_17_940 283
156 3300048919 Ga0496116_0013950 Ga0496116_0013950_5366_6244 283
157 3300048924 Ga0496121_0047070 Ga0496121_0047070_2063_2941 283
158 3300048924 Ga0496121_0105018 Ga0496121_0105018_1080_1958 283
159 3300048924 Ga0496121_0325933 Ga0496121_0325933_17_895 283
160 3300048925 Ga0496122_0001643 Ga0496122_0001643_32479_33357 283
161 3300048926 Ga0496123_0000755 Ga0496123_0000755_19059_19937 283
162 3300048928 Ga0496125_0000773 Ga0496125_0000773_1309_2187 283
163 3300048928 Ga0496125_0205522 Ga0496125_0205522_80_958 283
164 3300049743 Ga0501081_0216187 Ga0501081_0216187_432_1355 283
165 3300053139 Ga0500568_0001966 Ga0500568_0001966_4057_4962 283

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00892

EamA

EamA-like transporter family

5

143

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5y79-assembly1.cif.gz_B crystal structure of the triose-phosphate/phosphate translocator in complex with 3-phosphoglycerate 0.7235 2 267
7paf-assembly1.cif.gz_D streptococcus pneumoniae choline importer licb in lipid nanodiscs 0.695 3 264
7b0k-assembly1.cif.gz_A membrane protein structure 0.6932 3 264
5y79-assembly1.cif.gz_B crystal structure of the triose-phosphate/phosphate translocator in complex with 3-phosphoglycerate 0.6841 2 267
7b0k-assembly1.cif.gz_A membrane protein structure 0.6734 3 264
ID Description Score Start End Superfamily
af_Q8RY83_36_351_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7289 2 272 1.20.1740.10
af_Q8RY83_36_351_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6998 2 272 1.20.1740.10
af_Q20583_6_327_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6596 3 267 1.20.1740.10
af_Q20583_6_327_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6227 3 267 1.20.1740.10
af_A0A0P0YAS8_28_439_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.5659 3 267 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A7W3Y440-F1-model_v4 EamA family transporter RarD 0.9768 1 282 GO:0005886
AF-A0A7X6DIQ7-F1-model_v4 EamA family transporter RarD 0.9767 2 279 GO:0005886
AF-A5UTQ3-F1-model_v4 RarD protein, DMT superfamily transporter 0.9763 2 278 GO:0005886
AF-A0A1I2RTB6-F1-model_v4 Chloramphenicol-sensitive protein RarD 0.9754 2 272 GO:0005886
AF-A0A852ZU73-F1-model_v4 Chloramphenicol-sensitive protein RarD 0.9748 2 283 GO:0005886

Feature Viewer

pLDDT pTM Quality
91.43 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map