F246551
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 165 | 34 | 330 | 169 |
Family's Representative Sequence
| Representative Sequence | 3300033527|Ga0316586_1003553|Ga0316586_10035532 |
| Length | 185 |
| Sequence | LLNMAPTGALPNRAEQDEADGHRSSRLIVLGRIAGLYGVRGWVRVFSETDPKENILRYSPWLLEGDAHVVAEGRRHGKGLVVRLEGCSDRDQAANLVGRSICVHRDQLPPAQTDEFYWADLEGLAVETLAGESLGRVSHLFDTGANDVLVVKGDRERLLPFVWDDIVKDVDFQSGTIKVDWDPDF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 2 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 3 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 4 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 5 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 6 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 7 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 8 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 9 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 10 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 11 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 12 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 13 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 14 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 15 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 16 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 17 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 18 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 19 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 20 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 21 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 22 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 23 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 24 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 25 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 26 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 27 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 28 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 29 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 30 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 31 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 32 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 33 | 2836160341 | Unclassified Planctomycetes Bin 134 | Isolate | Unclassified |
| 34 | 2989392574 | Methylomonas rhizoryzae GJ1 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 60 |
| Metatranscriptomes | 38.79 |
| Isolates | 1.21 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 61.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.82 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0316586_1003553 | 3300033527 | Bacteria | 2057 |
| 2 | Ga0068869_101317640 | 3300005334 | Bacteria | 637 |
| 3 | Ga0070681_10000122 | 3300005458 | Bacteria | 58332 |
| 4 | Ga0157373_10081763 | 3300013100 | Bacteria | 2277 |
| 5 | Ga0207707_10000310 | 3300025912 | Bacteria | 51190 |
| 6 | Ga0265327_10172715 | 3300031251 | Bacteria | 992 |
| 7 | Ga0316575_10060187 | 3300031665 | Bacteria | 1516 |
| 8 | Ga0316575_10077275 | 3300031665 | Bacteria | 1341 |
| 9 | Ga0316579_10002198 | 3300031691 | Bacteria | 7352 |
| 10 | Ga0316579_10056870 | 3300031691 | Bacteria | 1837 |
| 11 | Ga0316579_10060244 | 3300031691 | Bacteria | 1785 |
| 12 | Ga0316579_10106728 | 3300031691 | Bacteria | 1343 |
| 13 | Ga0316576_10001368 | 3300031727 | Bacteria | 13015 |
| 14 | Ga0316576_10021165 | 3300031727 | Bacteria | 4493 |
| 15 | Ga0316576_10027702 | 3300031727 | Bacteria | 3985 |
| 16 | Ga0316576_10179353 | 3300031727 | Bacteria | 1597 |
| 17 | Ga0316576_10254361 | 3300031727 | Bacteria | 1318 |
| 18 | Ga0316576_10618709 | 3300031727 | Unclassified | 790 |
| 19 | Ga0316578_10005951 | 3300031728 | Bacteria | 5971 |
| 20 | Ga0316578_10009209 | 3300031728 | Bacteria | 5068 |
| 21 | Ga0316578_10168976 | 3300031728 | Bacteria | 1318 |
| 22 | Ga0316577_10011504 | 3300031733 | Bacteria | 4795 |
| 23 | Ga0316577_10022035 | 3300031733 | Bacteria | 3536 |
| 24 | Ga0316583_10047776 | 3300032133 | Bacteria | 1508 |
| 25 | Ga0316583_10108169 | 3300032133 | Bacteria | 969 |
| 26 | Ga0316580_10062668 | 3300032139 | Bacteria | 1141 |
| 27 | Ga0316593_10000702 | 3300032168 | Bacteria | 6538 |
| 28 | Ga0316593_10002527 | 3300032168 | Bacteria | 4363 |
| 29 | Ga0316593_10008753 | 3300032168 | Bacteria | 2835 |
| 30 | Ga0316593_10009511 | 3300032168 | Bacteria | 2748 |
| 31 | Ga0316593_10012771 | 3300032168 | Bacteria | 2471 |
| 32 | Ga0316593_10019654 | 3300032168 | Bacteria | 2090 |
| 33 | Ga0316593_10026492 | 3300032168 | Bacteria | 1854 |
| 34 | Ga0316593_10028391 | 3300032168 | Bacteria | 1803 |
| 35 | Ga0316593_10030415 | 3300032168 | Bacteria | 1753 |
| 36 | Ga0316593_10041158 | 3300032168 | Bacteria | 1537 |
| 37 | Ga0316593_10044992 | 3300032168 | Bacteria | 1478 |
| 38 | Ga0316593_10083139 | 3300032168 | Bacteria | 1120 |
| 39 | Ga0316593_10083226 | 3300032168 | Bacteria | 1119 |
| 40 | Ga0316593_10086256 | 3300032168 | Bacteria | 1101 |
| 41 | Ga0316593_10104954 | 3300032168 | Bacteria | 1005 |
| 42 | Ga0316593_10115474 | 3300032168 | Bacteria | 961 |
| 43 | Ga0316593_10134127 | 3300032168 | Bacteria | 895 |
| 44 | Ga0316593_10136591 | 3300032168 | Unclassified | 887 |
| 45 | Ga0316593_10139828 | 3300032168 | Bacteria | 877 |
| 46 | Ga0316593_10141843 | 3300032168 | Bacteria | 871 |
| 47 | Ga0316592_1004811 | 3300033524 | Bacteria | 2530 |
| 48 | Ga0316592_1005136 | 3300033524 | Bacteria | 2470 |
| 49 | Ga0316592_1006937 | 3300033524 | Bacteria | 2198 |
| 50 | Ga0316592_1019489 | 3300033524 | Bacteria | 1435 |
| 51 | Ga0316592_1024875 | 3300033524 | Bacteria | 1289 |
| 52 | Ga0316592_1033984 | 3300033524 | Bacteria | 1116 |
| 53 | Ga0316592_1034266 | 3300033524 | Bacteria | 1112 |
| 54 | Ga0316592_1057154 | 3300033524 | Bacteria | 874 |
| 55 | Ga0316586_1002434 | 3300033527 | Bacteria | 2318 |
| 56 | Ga0316586_1004257 | 3300033527 | Bacteria | 1942 |
| 57 | Ga0316586_1006621 | 3300033527 | Bacteria | 1667 |
| 58 | Ga0316586_1021392 | 3300033527 | Bacteria | 1069 |
| 59 | Ga0316586_1023976 | 3300033527 | Bacteria | 1021 |
| 60 | Ga0316586_1024283 | 3300033527 | Unclassified | 1016 |
| 61 | Ga0316588_1004524 | 3300033528 | Bacteria | 2642 |
| 62 | Ga0316588_1010076 | 3300033528 | Bacteria | 1984 |
| 63 | Ga0316588_1018369 | 3300033528 | Bacteria | 1566 |
| 64 | Ga0316588_1025465 | 3300033528 | Bacteria | 1367 |
| 65 | Ga0316588_1033929 | 3300033528 | Bacteria | 1204 |
| 66 | Ga0316588_1041177 | 3300033528 | Bacteria | 1105 |
| 67 | Ga0316587_1001625 | 3300033529 | Bacteria | 2827 |
| 68 | Ga0316587_1002109 | 3300033529 | Bacteria | 2604 |
| 69 | Ga0316587_1002999 | 3300033529 | Bacteria | 2318 |
| 70 | Ga0316587_1006628 | 3300033529 | Bacteria | 1776 |
| 71 | Ga0316587_1008734 | 3300033529 | Bacteria | 1597 |
| 72 | Ga0316587_1016912 | 3300033529 | Bacteria | 1219 |
| 73 | Ga0316587_1018471 | 3300033529 | Bacteria | 1175 |
| 74 | Ga0316587_1020982 | 3300033529 | Bacteria | 1112 |
| 75 | Ga0316587_1040092 | 3300033529 | Bacteria | 845 |
| 76 | Ga0316587_1047101 | 3300033529 | Bacteria | 785 |
| 77 | Ga0316587_1056394 | 3300033529 | Bacteria | 724 |
| 78 | Ga0316596_1001628 | 3300033541 | Bacteria | 4607 |
| 79 | Ga0316596_1004536 | 3300033541 | Bacteria | 3122 |
| 80 | Ga0316596_1005947 | 3300033541 | Bacteria | 2813 |
| 81 | Ga0316596_1007430 | 3300033541 | Bacteria | 2589 |
| 82 | Ga0316596_1010266 | 3300033541 | Bacteria | 2263 |
| 83 | Ga0316596_1017000 | 3300033541 | Bacteria | 1826 |
| 84 | Ga0316596_1018937 | 3300033541 | Bacteria | 1743 |
| 85 | Ga0316596_1019218 | 3300033541 | Bacteria | 1733 |
| 86 | Ga0316596_1023450 | 3300033541 | Bacteria | 1581 |
| 87 | Ga0316596_1027076 | 3300033541 | Bacteria | 1479 |
| 88 | Ga0316596_1036079 | 3300033541 | Bacteria | 1292 |
| 89 | Ga0316596_1060605 | 3300033541 | Bacteria | 1009 |
| 90 | Ga0316574_0008854 | 3300035398 | Bacteria | 5612 |
| 91 | Ga0316574_0026910 | 3300035398 | Bacteria | 3461 |
| 92 | Ga0316574_0034477 | 3300035398 | Bacteria | 3086 |
| 93 | Ga0316582_0043194 | 3300036647 | Bacteria | 2827 |
| 94 | Ga0316582_0389878 | 3300036647 | Bacteria | 959 |
| 95 | Ga0316582_0525125 | 3300036647 | Bacteria | 816 |
| 96 | Ga0316584_0086498 | 3300036712 | Bacteria | 2346 |
| 97 | Ga0316584_0383775 | 3300036712 | Bacteria | 1003 |
| 98 | Ga0400484_04568 | 3300038725 | Bacteria | 3550 |
| 99 | Ga0400484_06581 | 3300038725 | Bacteria | 1051 |
| 100 | Ga0400484_08517 | 3300038725 | Bacteria | 1297 |
| 101 | Ga0400484_39795 | 3300038725 | Bacteria | 11914 |
| 102 | Ga0400484_41466 | 3300038725 | Bacteria | 1499 |
| 103 | Ga0400484_44116 | 3300038725 | Bacteria | 10878 |
| 104 | Ga0400490_01456 | 3300038726 | Bacteria | 2143 |
| 105 | Ga0400490_07088 | 3300038726 | Bacteria | 2570 |
| 106 | Ga0400490_14181 | 3300038726 | Bacteria | 1657 |
| 107 | Ga0400490_21193 | 3300038726 | Bacteria | 3552 |
| 108 | Ga0400490_39871 | 3300038726 | Bacteria | 6650 |
| 109 | Ga0400490_41264 | 3300038726 | Bacteria | 84677 |
| 110 | Ga0400490_48967 | 3300038726 | Bacteria | 1850 |
| 111 | Ga0400490_52169 | 3300038726 | Bacteria | 17663 |
| 112 | Ga0400490_52315 | 3300038726 | Bacteria | 1695 |
| 113 | Ga0400491_08296 | 3300038727 | Bacteria | 1320 |
| 114 | Ga0400491_08916 | 3300038727 | Bacteria | 1919 |
| 115 | Ga0400491_13041 | 3300038727 | Bacteria | 1128 |
| 116 | Ga0400491_23708 | 3300038727 | Bacteria | 1200 |
| 117 | Ga0400485_03917 | 3300038735 | Bacteria | 1425 |
| 118 | Ga0400485_07724 | 3300038735 | Bacteria | 7326 |
| 119 | Ga0400485_18896 | 3300038735 | Bacteria | 72885 |
| 120 | Ga0400488_13114 | 3300038741 | Bacteria | 1261 |
| 121 | Ga0400488_28249 | 3300038741 | Bacteria | 3983 |
| 122 | Ga0400488_35496 | 3300038741 | Bacteria | 1835 |
| 123 | Ga0400488_35784 | 3300038741 | Bacteria | 1568 |
| 124 | Ga0400488_36082 | 3300038741 | Bacteria | 1551 |
| 125 | Ga0400488_37987 | 3300038741 | Bacteria | 1524 |
| 126 | Ga0400488_43978 | 3300038741 | Bacteria | 16431 |
| 127 | Ga0400488_47445 | 3300038741 | Bacteria | 1154 |
| 128 | Ga0400486_12111 | 3300038742 | Bacteria | 6365 |
| 129 | Ga0400486_12648 | 3300038742 | Bacteria | 1082 |
| 130 | Ga0400486_19627 | 3300038742 | Bacteria | 369894 |
| 131 | Ga0400486_20795 | 3300038742 | Bacteria | 1959 |
| 132 | Ga0400486_23726 | 3300038742 | Bacteria | 1940 |
| 133 | Ga0400486_24352 | 3300038742 | Bacteria | 2382 |
| 134 | Ga0400483_003711 | 3300039062 | Bacteria | 4871 |
| 135 | Ga0400483_024375 | 3300039062 | Bacteria | 5091 |
| 136 | Ga0400483_047073 | 3300039062 | Bacteria | 2400 |
| 137 | Ga0400483_054834 | 3300039062 | Bacteria | 1329 |
| 138 | Ga0400483_091595 | 3300039062 | Bacteria | 4572 |
| 139 | Ga0400483_097253 | 3300039062 | Bacteria | 5649 |
| 140 | Ga0400483_116941 | 3300039062 | Bacteria | 2933 |
| 141 | Ga0400483_157294 | 3300039062 | Bacteria | 17208 |
| 142 | Ga0400483_161726 | 3300039062 | Bacteria | 1139 |
| 143 | Ga0400483_188370 | 3300039062 | Bacteria | 17777 |
| 144 | Ga0400483_189140 | 3300039062 | Bacteria | 7579 |
| 145 | Ga0400483_195523 | 3300039062 | Bacteria | 14201 |
| 146 | Ga0400483_208518 | 3300039062 | Bacteria | 2348 |
| 147 | Ga0400483_242051 | 3300039062 | Bacteria | 5619 |
| 148 | Ga0400483_276159 | 3300039062 | Bacteria | 1858 |
| 149 | Ga0400483_281959 | 3300039062 | Bacteria | 2981 |
| 150 | Ga0400489_49590 | 3300039093 | Bacteria | 5512 |
| 151 | Ga0400487_07260 | 3300039110 | Bacteria | 1763 |
| 152 | Ga0400487_12712 | 3300039110 | Bacteria | 1794 |
| 153 | Ga0400487_13622 | 3300039110 | Bacteria | 1929 |
| 154 | Ga0400487_24681 | 3300039110 | Bacteria | 1322 |
| 155 | Ga0400487_31408 | 3300039110 | Bacteria | 34683 |
| 156 | Ga0400487_38859 | 3300039110 | Bacteria | 12497 |
| 157 | Ga0400487_64163 | 3300039110 | Bacteria | 12120 |
| 158 | Ga0400487_66353 | 3300039110 | Bacteria | 11859 |
| 159 | Ga0400487_66534 | 3300039110 | Bacteria | 4967 |
| 160 | Ga0451577_0000852 | 3300042876 | Bacteria | 45450 |
| 161 | Ga0453684_0002092 | 3300044712 | Bacteria | 50519 |
| 162 | Ga0453684_0018446 | 3300044712 | Bacteria | 10709 |
| 163 | Ga0453684_0567043 | 3300044712 | Bacteria | 1248 |
| 164 | 2836161017 | 2836160341 | Unclassified | 5867367 |
| 165 | 2989393131 | 2989392574 | Bacteria | 4554005 |
| 166 | Ga0316586_1003553 | |||
| 167 | Ga0068869_101317640 | |||
| 168 | Ga0070681_10000122 | |||
| 169 | Ga0157373_10081763 | |||
| 170 | Ga0207707_10000310 | |||
| 171 | Ga0265327_10172715 | |||
| 172 | Ga0316575_10060187 | |||
| 173 | Ga0316575_10077275 | |||
| 174 | Ga0316579_10002198 | |||
| 175 | Ga0316579_10056870 | |||
| 176 | Ga0316579_10060244 | |||
| 177 | Ga0316579_10106728 | |||
| 178 | Ga0316576_10001368 | |||
| 179 | Ga0316576_10021165 | |||
| 180 | Ga0316576_10027702 | |||
| 181 | Ga0316576_10179353 | |||
| 182 | Ga0316576_10254361 | |||
| 183 | Ga0316576_10618709 | |||
| 184 | Ga0316578_10005951 | |||
| 185 | Ga0316578_10009209 | |||
| 186 | Ga0316578_10168976 | |||
| 187 | Ga0316577_10011504 | |||
| 188 | Ga0316577_10022035 | |||
| 189 | Ga0316583_10047776 | |||
| 190 | Ga0316583_10108169 | |||
| 191 | Ga0316580_10062668 | |||
| 192 | Ga0316593_10000702 | |||
| 193 | Ga0316593_10002527 | |||
| 194 | Ga0316593_10008753 | |||
| 195 | Ga0316593_10009511 | |||
| 196 | Ga0316593_10012771 | |||
| 197 | Ga0316593_10019654 | |||
| 198 | Ga0316593_10026492 | |||
| 199 | Ga0316593_10028391 | |||
| 200 | Ga0316593_10030415 | |||
| 201 | Ga0316593_10041158 | |||
| 202 | Ga0316593_10044992 | |||
| 203 | Ga0316593_10083139 | |||
| 204 | Ga0316593_10083226 | |||
| 205 | Ga0316593_10086256 | |||
| 206 | Ga0316593_10104954 | |||
| 207 | Ga0316593_10115474 | |||
| 208 | Ga0316593_10134127 | |||
| 209 | Ga0316593_10136591 | |||
| 210 | Ga0316593_10139828 | |||
| 211 | Ga0316593_10141843 | |||
| 212 | Ga0316592_1004811 | |||
| 213 | Ga0316592_1005136 | |||
| 214 | Ga0316592_1006937 | |||
| 215 | Ga0316592_1019489 | |||
| 216 | Ga0316592_1024875 | |||
| 217 | Ga0316592_1033984 | |||
| 218 | Ga0316592_1034266 | |||
| 219 | Ga0316592_1057154 | |||
| 220 | Ga0316586_1002434 | |||
| 221 | Ga0316586_1004257 | |||
| 222 | Ga0316586_1006621 | |||
| 223 | Ga0316586_1021392 | |||
| 224 | Ga0316586_1023976 | |||
| 225 | Ga0316586_1024283 | |||
| 226 | Ga0316588_1004524 | |||
| 227 | Ga0316588_1010076 | |||
| 228 | Ga0316588_1018369 | |||
| 229 | Ga0316588_1025465 | |||
| 230 | Ga0316588_1033929 | |||
| 231 | Ga0316588_1041177 | |||
| 232 | Ga0316587_1001625 | |||
| 233 | Ga0316587_1002109 | |||
| 234 | Ga0316587_1002999 | |||
| 235 | Ga0316587_1006628 | |||
| 236 | Ga0316587_1008734 | |||
| 237 | Ga0316587_1016912 | |||
| 238 | Ga0316587_1018471 | |||
| 239 | Ga0316587_1020982 | |||
| 240 | Ga0316587_1040092 | |||
| 241 | Ga0316587_1047101 | |||
| 242 | Ga0316587_1056394 | |||
| 243 | Ga0316596_1001628 | |||
| 244 | Ga0316596_1004536 | |||
| 245 | Ga0316596_1005947 | |||
| 246 | Ga0316596_1007430 | |||
| 247 | Ga0316596_1010266 | |||
| 248 | Ga0316596_1017000 | |||
| 249 | Ga0316596_1018937 | |||
| 250 | Ga0316596_1019218 | |||
| 251 | Ga0316596_1023450 | |||
| 252 | Ga0316596_1027076 | |||
| 253 | Ga0316596_1036079 | |||
| 254 | Ga0316596_1060605 | |||
| 255 | Ga0316574_0008854 | |||
| 256 | Ga0316574_0026910 | |||
| 257 | Ga0316574_0034477 | |||
| 258 | Ga0316582_0043194 | |||
| 259 | Ga0316582_0389878 | |||
| 260 | Ga0316582_0525125 | |||
| 261 | Ga0316584_0086498 | |||
| 262 | Ga0316584_0383775 | |||
| 263 | Ga0400484_04568 | |||
| 264 | Ga0400484_06581 | |||
| 265 | Ga0400484_08517 | |||
| 266 | Ga0400484_39795 | |||
| 267 | Ga0400484_41466 | |||
| 268 | Ga0400484_44116 | |||
| 269 | Ga0400490_01456 | |||
| 270 | Ga0400490_07088 | |||
| 271 | Ga0400490_14181 | |||
| 272 | Ga0400490_21193 | |||
| 273 | Ga0400490_39871 | |||
| 274 | Ga0400490_41264 | |||
| 275 | Ga0400490_48967 | |||
| 276 | Ga0400490_52169 | |||
| 277 | Ga0400490_52315 | |||
| 278 | Ga0400491_08296 | |||
| 279 | Ga0400491_08916 | |||
| 280 | Ga0400491_13041 | |||
| 281 | Ga0400491_23708 | |||
| 282 | Ga0400485_03917 | |||
| 283 | Ga0400485_07724 | |||
| 284 | Ga0400485_18896 | |||
| 285 | Ga0400488_13114 | |||
| 286 | Ga0400488_28249 | |||
| 287 | Ga0400488_35496 | |||
| 288 | Ga0400488_35784 | |||
| 289 | Ga0400488_36082 | |||
| 290 | Ga0400488_37987 | |||
| 291 | Ga0400488_43978 | |||
| 292 | Ga0400488_47445 | |||
| 293 | Ga0400486_12111 | |||
| 294 | Ga0400486_12648 | |||
| 295 | Ga0400486_19627 | |||
| 296 | Ga0400486_20795 | |||
| 297 | Ga0400486_23726 | |||
| 298 | Ga0400486_24352 | |||
| 299 | Ga0400483_003711 | |||
| 300 | Ga0400483_024375 | |||
| 301 | Ga0400483_047073 | |||
| 302 | Ga0400483_054834 | |||
| 303 | Ga0400483_091595 | |||
| 304 | Ga0400483_097253 | |||
| 305 | Ga0400483_116941 | |||
| 306 | Ga0400483_157294 | |||
| 307 | Ga0400483_161726 | |||
| 308 | Ga0400483_188370 | |||
| 309 | Ga0400483_189140 | |||
| 310 | Ga0400483_195523 | |||
| 311 | Ga0400483_208518 | |||
| 312 | Ga0400483_242051 | |||
| 313 | Ga0400483_276159 | |||
| 314 | Ga0400483_281959 | |||
| 315 | Ga0400489_49590 | |||
| 316 | Ga0400487_07260 | |||
| 317 | Ga0400487_12712 | |||
| 318 | Ga0400487_13622 | |||
| 319 | Ga0400487_24681 | |||
| 320 | Ga0400487_31408 | |||
| 321 | Ga0400487_38859 | |||
| 322 | Ga0400487_64163 | |||
| 323 | Ga0400487_66353 | |||
| 324 | Ga0400487_66534 | |||
| 325 | Ga0451577_0000852 | |||
| 326 | Ga0453684_0002092 | |||
| 327 | Ga0453684_0018446 | |||
| 328 | Ga0453684_0567043 | |||
| 329 | 2836161017 | |||
| 330 | 2989393131 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2dog-assembly1.cif.gz_A | solution structure of the n-terminal domain of rimm from thermus thermophilus hb8 | 0.8745 | 9 | 97 |
| 7cq1-assembly1.cif.gz_A | solution structure of the c-terminal domain of mycobacterium tuberculosis ribosome maturation factor protein rimm | 0.8682 | 102 | 167 |
| 3a1p-assembly2.cif.gz_C | structure of ribosome maturation protein rimm and ribosomal protein s19 | 0.8351 | 8 | 170 |
| 2dog-assembly1.cif.gz_A | solution structure of the n-terminal domain of rimm from thermus thermophilus hb8 | 0.8279 | 9 | 97 |
| 3a1p-assembly2.cif.gz_C | structure of ribosome maturation protein rimm and ribosomal protein s19 | 0.8114 | 8 | 170 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A7X6_101_182_2.30.30.240 | Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain | 0.9704 | 98 | 172 | 2.30.30.240 |
| af_Q2FZ44_92_167_2.30.30.240 | Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain | 0.9586 | 98 | 166 | 2.30.30.240 |
| 2f1lA01 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;RimM | 0.9463 | 8 | 97 | 2.40.30.60 |
| af_P9WH19_99_175_2.30.30.240 | Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain | 0.9367 | 99 | 167 | 2.30.30.240 |
| 2f1lA01 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;RimM | 0.9362 | 8 | 97 | 2.40.30.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-V4JVA2-F1-model_v4 | Ribosome maturation factor RimM | 0.9538 | 5 | 172 |
GO:0005737
GO:0005840 GO:0006364 GO:0042274 GO:0043022 |
| AF-A0A3C0JA34-F1-model_v4 | Ribosome maturation factor RimM | 0.9436 | 7 | 152 |
GO:0005737
GO:0005840 GO:0006364 GO:0043022 |
| AF-Q8PMY2-F1-model_v4 | Ribosome maturation factor RimM | 0.939 | 4 | 172 |
GO:0005737
GO:0005840 GO:0006364 GO:0042274 GO:0043022 |
| AF-A0A351MBF1-F1-model_v4 | Ribosome maturation factor RimM | 0.9287 | 1 | 172 |
GO:0005737
GO:0005840 GO:0006364 GO:0042274 GO:0043022 |
| AF-Q8PMY2-F1-model_v4 | Ribosome maturation factor RimM | 0.9285 | 4 | 172 |
GO:0005737
GO:0005840 GO:0006364 GO:0042274 GO:0043022 |