F246488

General Info

Members Datasets Scaffolds Average Seq Length
165 76 330 163

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_101044016|Ga0307408_1010440161
Length 187
Sequence MSEFASSSDSRAASADVADERRRGGRGSVRPIRPDDVPAAVALVRELAEYEKALHEVLLTEQQLTERLFGDAPALFGHVAEVDGEVVGIALWFLNFSTWRGTHGIYLEDLYVQHQHRGSGLGKELLRTLAAVCVERGYSRLEWAVLDWNTPSIDFYKAAGAVPLDEWTVFRLTDDALTTFAEDRRAR

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
14 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
15 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
16 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
17 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
18 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
28 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
29 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
30 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
31 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
32 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
33 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
34 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
35 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
36 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
37 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
38 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
39 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
40 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
41 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
42 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
43 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
44 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
45 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
46 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
47 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
48 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
49 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
50 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
51 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
52 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
53 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
54 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
55 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
56 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
57 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
58 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
59 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
60 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
61 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
62 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
63 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
64 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
65 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
66 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
67 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
68 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
69 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
70 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
71 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
72 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
73 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
74 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
75 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
76 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.36
Metatranscriptomes 1.21
Isolates 2.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.21
Nodule 0
Rhizoplane 0.61
Rhizosphere 97.58
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_101044016 3300031548 Bacteria 755
2 LJQas_1007820 3300000549 Bacteria 1310
3 LJQas_1017246 3300000549 Bacteria 842
4 LJQas_1018675 3300000549 Bacteria 806
5 Ga0070658_10490322 3300005327 Bacteria 1061
6 Ga0068869_101403734 3300005334 Bacteria 618
7 Ga0070680_100690340 3300005336 Bacteria 878
8 Ga0070682_100975099 3300005337 Bacteria 702
9 Ga0070661_100276430 3300005344 Bacteria 1302
10 Ga0070673_100998663 3300005364 Bacteria 779
11 Ga0070659_100422362 3300005366 Bacteria 1128
12 Ga0070663_100982654 3300005455 Bacteria 733
13 Ga0070707_101548476 3300005468 Bacteria 630
14 Ga0070679_100131876 3300005530 Bacteria 2479
15 Ga0068870_10292778 3300005840 Bacteria 1025
16 Ga0105245_10207681 3300009098 Bacteria 1883
17 Ga0163162_11135468 3300013306 Bacteria 886
18 Ga0206354_10195399 3300020081 Bacteria 2496
19 Ga0206353_11911463 3300020082 Bacteria 2845
20 Ga0207643_10281290 3300025908 Bacteria 1032
21 Ga0207660_10269938 3300025917 Bacteria 1348
22 Ga0207649_10210826 3300025920 Bacteria 1378
23 Ga0207652_10463239 3300025921 Bacteria 1142
24 Ga0207687_10582707 3300025927 Bacteria 941
25 Ga0207664_10592276 3300025929 Bacteria 996
26 Ga0207661_10956612 3300025944 Bacteria 789
27 Ga0207679_10646186 3300025945 Bacteria 956
28 Ga0207683_11282628 3300026121 Bacteria 678
29 Ga0209371_1017383 3300027312 Bacteria 1864
30 Ga0268256_1019088 3300030500 Bacteria 1885
31 Ga0316181_1048071 3300030744 Bacteria 1373
32 Ga0307408_100032781 3300031548 Bacteria 3624
33 Ga0307408_100146790 3300031548 Bacteria 1858
34 Ga0307408_101908531 3300031548 Bacteria 570
35 Ga0307405_10117509 3300031731 Bacteria 1813
36 Ga0307405_10654285 3300031731 Bacteria 865
37 Ga0307405_11027748 3300031731 Bacteria 705
38 Ga0307413_10473182 3300031824 Bacteria 1000
39 Ga0307410_10005870 3300031852 Bacteria 6556
40 Ga0307410_10057371 3300031852 Bacteria 2651
41 Ga0307410_10228871 3300031852 Bacteria 1434
42 Ga0307410_10511894 3300031852 Bacteria 989
43 Ga0307410_10638314 3300031852 Bacteria 892
44 Ga0307406_10033800 3300031901 Bacteria 3132
45 Ga0307406_10145299 3300031901 Bacteria 1684
46 Ga0307406_10211019 3300031901 Bacteria 1436
47 Ga0307406_10230238 3300031901 Bacteria 1383
48 Ga0307406_10645257 3300031901 Bacteria 878
49 Ga0307406_11009535 3300031901 Bacteria 714
50 Ga0307406_11154734 3300031901 Bacteria 671
51 Ga0307407_10023333 3300031903 Bacteria 3227
52 Ga0307407_10055840 3300031903 Bacteria 2283
53 Ga0307407_10477236 3300031903 Bacteria 910
54 Ga0307412_10302820 3300031911 Bacteria 1264
55 Ga0307412_11130470 3300031911 Bacteria 698
56 Ga0307412_11427275 3300031911 Bacteria 627
57 Ga0307412_11615392 3300031911 Bacteria 592
58 Ga0307409_100018267 3300031995 Bacteria 4707
59 Ga0307409_100059220 3300031995 Bacteria 2979
60 Ga0307409_100065497 3300031995 Bacteria 2860
61 Ga0307409_100193332 3300031995 Bacteria 1813
62 Ga0307409_100203359 3300031995 Bacteria 1774
63 Ga0307409_100213120 3300031995 Bacteria 1737
64 Ga0307409_100705842 3300031995 Bacteria 1008
65 Ga0307409_101223372 3300031995 Bacteria 775
66 Ga0307409_101496407 3300031995 Bacteria 702
67 Ga0307416_100019953 3300032002 Bacteria 4768
68 Ga0307416_100044543 3300032002 Bacteria 3485
69 Ga0307416_100257387 3300032002 Bacteria 1703
70 Ga0307416_101110668 3300032002 Bacteria 895
71 Ga0307416_101115952 3300032002 Bacteria 893
72 Ga0307416_101187841 3300032002 Bacteria 868
73 Ga0307416_101191666 3300032002 Bacteria 867
74 Ga0307414_10050755 3300032004 Bacteria 2875
75 Ga0307414_10099360 3300032004 Bacteria 2186
76 Ga0307414_10378168 3300032004 Bacteria 1224
77 Ga0307414_10674513 3300032004 Bacteria 934
78 Ga0307411_10081966 3300032005 Bacteria 2223
79 Ga0307411_10140143 3300032005 Bacteria 1782
80 Ga0307411_10495845 3300032005 Bacteria 1031
81 Ga0307411_11241793 3300032005 Bacteria 677
82 Ga0307411_11555924 3300032005 Bacteria 609
83 Ga0307411_11877428 3300032005 Bacteria 557
84 Ga0307415_100021399 3300032126 Bacteria 3974
85 Ga0307415_100027588 3300032126 Bacteria 3600
86 Ga0307415_100059692 3300032126 Bacteria 2631
87 Ga0307415_100176562 3300032126 Bacteria 1671
88 Ga0307415_100368790 3300032126 Bacteria 1215
89 Ga0307415_100546451 3300032126 Bacteria 1021
90 Ga0307415_100787499 3300032126 Bacteria 867
91 Ga0373960_0159383 3300035121 Bacteria 776
92 Ga0373947_0909996 3300035725 Bacteria 601
93 Ga0395900_0007733 3300037418 Bacteria 11086
94 Ga0395900_0478794 3300037418 Bacteria 1197
95 Ga0395898_0086738 3300037466 Bacteria 3016
96 Ga0395898_0109155 3300037466 Bacteria 2653
97 Ga0395901_0173339 3300038443 Bacteria 2263
98 Ga0395901_0278445 3300038443 Bacteria 1739
99 Ga0395901_0748268 3300038443 Bacteria 971
100 Ga0439464_0257098 3300042439 Bacteria 565
101 Ga0466972_0117032 3300044658 Bacteria 1258
102 Ga0466972_0268295 3300044658 Bacteria 798
103 Ga0466965_0129457 3300044683 Bacteria 1308
104 Ga0466965_0320278 3300044683 Bacteria 844
105 Ga0466965_0458304 3300044683 Bacteria 711
106 Ga0466966_0097309 3300044684 Bacteria 1822
107 Ga0466966_0214807 3300044684 Bacteria 1162
108 Ga0466966_0401185 3300044684 Bacteria 824
109 Ga0466961_0033873 3300044693 Bacteria 3282
110 Ga0466961_0047384 3300044693 Bacteria 2748
111 Ga0466961_0051272 3300044693 Bacteria 2636
112 Ga0466961_0069329 3300044693 Bacteria 2239
113 Ga0466961_0076059 3300044693 Bacteria 2128
114 Ga0466961_0141315 3300044693 Bacteria 1507
115 Ga0466963_0011058 3300044694 Bacteria 5487
116 Ga0466963_0109847 3300044694 Bacteria 1892
117 Ga0466963_0148065 3300044694 Bacteria 1630
118 Ga0466963_0941543 3300044694 Bacteria 608
119 Ga0466964_0159253 3300044706 Bacteria 1054
120 Ga0466971_0046257 3300044719 Bacteria 1956
121 Ga0466971_0061091 3300044719 Bacteria 1703
122 Ga0466971_0422945 3300044719 Bacteria 651
123 Ga0466970_0079813 3300044765 Bacteria 1767
124 Ga0466970_0081197 3300044765 Bacteria 1753
125 Ga0466970_0091268 3300044765 Bacteria 1653
126 Ga0466957_0058457 3300044842 Bacteria 2362
127 Ga0466957_0079449 3300044842 Bacteria 2041
128 Ga0466957_0226260 3300044842 Bacteria 1237
129 Ga0466957_0275271 3300044842 Bacteria 1125
130 Ga0466957_1147208 3300044842 Bacteria 561
131 Ga0466960_0011911 3300044901 Bacteria 3658
132 Ga0466960_0062932 3300044901 Bacteria 1825
133 Ga0466959_0057817 3300045049 Bacteria 2826
134 Ga0466959_0162126 3300045049 Bacteria 1571
135 Ga0466959_0246322 3300045049 Bacteria 1233
136 Ga0466959_0247262 3300045049 Bacteria 1231
137 Ga0466959_0583481 3300045049 Bacteria 752
138 Ga0466958_0165731 3300045836 Bacteria 1398
139 Ga0466958_0846674 3300045836 Bacteria 596
140 Ga0466967_0000899 3300045976 Bacteria 15915
141 Ga0466967_0028092 3300045976 Bacteria 4691
142 Ga0466967_0077997 3300045976 Bacteria 2983
143 Ga0466967_0098461 3300045976 Bacteria 2670
144 Ga0466967_0122623 3300045976 Bacteria 2404
145 Ga0466967_0233719 3300045976 Bacteria 1751
146 Ga0466967_1530870 3300045976 Bacteria 664
147 Ga0495596_0060078 3300046500 Bacteria 1481
148 Ga0495631_0097130 3300046518 Bacteria 1268
149 Ga0495663_0021191 3300046525 Bacteria 1871
150 Ga0495598_0131250 3300046537 Bacteria 859
151 Ga0495668_0367434 3300046616 Bacteria 790
152 Ga0495661_0302614 3300046665 Bacteria 800
153 Ga0495615_0076566 3300048090 Bacteria 911
154 Ga0496111_0248732 3300048914 Bacteria 1320
155 Ga0501072_1242669 3300049588 Bacteria 578
156 Ga0501045_0625143 3300049824 Bacteria 797
157 Ga0500559_0005952 3300053136 Bacteria 5543
158 Ga0500616_0001353 3300053153 Bacteria 23929
159 Ga0466962_0171016 3300061719 Bacteria 1058
160 Ga0466962_0216898 3300061719 Bacteria 936
161 Ga0466962_0377694 3300061719 Bacteria 708
162 2623501668 2622736605 Bacteria 4992138
163 2673163382 2671180531 Bacteria 9045424
164 2676475775 2675903058 Bacteria 6822861
165 2827630336 2827628540 Bacteria 6858585
166 Ga0307408_101044016
167 LJQas_1007820
168 LJQas_1017246
169 LJQas_1018675
170 Ga0070658_10490322
171 Ga0068869_101403734
172 Ga0070680_100690340
173 Ga0070682_100975099
174 Ga0070661_100276430
175 Ga0070673_100998663
176 Ga0070659_100422362
177 Ga0070663_100982654
178 Ga0070707_101548476
179 Ga0070679_100131876
180 Ga0068870_10292778
181 Ga0105245_10207681
182 Ga0163162_11135468
183 Ga0206354_10195399
184 Ga0206353_11911463
185 Ga0207643_10281290
186 Ga0207660_10269938
187 Ga0207649_10210826
188 Ga0207652_10463239
189 Ga0207687_10582707
190 Ga0207664_10592276
191 Ga0207661_10956612
192 Ga0207679_10646186
193 Ga0207683_11282628
194 Ga0209371_1017383
195 Ga0268256_1019088
196 Ga0316181_1048071
197 Ga0307408_100032781
198 Ga0307408_100146790
199 Ga0307408_101908531
200 Ga0307405_10117509
201 Ga0307405_10654285
202 Ga0307405_11027748
203 Ga0307413_10473182
204 Ga0307410_10005870
205 Ga0307410_10057371
206 Ga0307410_10228871
207 Ga0307410_10511894
208 Ga0307410_10638314
209 Ga0307406_10033800
210 Ga0307406_10145299
211 Ga0307406_10211019
212 Ga0307406_10230238
213 Ga0307406_10645257
214 Ga0307406_11009535
215 Ga0307406_11154734
216 Ga0307407_10023333
217 Ga0307407_10055840
218 Ga0307407_10477236
219 Ga0307412_10302820
220 Ga0307412_11130470
221 Ga0307412_11427275
222 Ga0307412_11615392
223 Ga0307409_100018267
224 Ga0307409_100059220
225 Ga0307409_100065497
226 Ga0307409_100193332
227 Ga0307409_100203359
228 Ga0307409_100213120
229 Ga0307409_100705842
230 Ga0307409_101223372
231 Ga0307409_101496407
232 Ga0307416_100019953
233 Ga0307416_100044543
234 Ga0307416_100257387
235 Ga0307416_101110668
236 Ga0307416_101115952
237 Ga0307416_101187841
238 Ga0307416_101191666
239 Ga0307414_10050755
240 Ga0307414_10099360
241 Ga0307414_10378168
242 Ga0307414_10674513
243 Ga0307411_10081966
244 Ga0307411_10140143
245 Ga0307411_10495845
246 Ga0307411_11241793
247 Ga0307411_11555924
248 Ga0307411_11877428
249 Ga0307415_100021399
250 Ga0307415_100027588
251 Ga0307415_100059692
252 Ga0307415_100176562
253 Ga0307415_100368790
254 Ga0307415_100546451
255 Ga0307415_100787499
256 Ga0373960_0159383
257 Ga0373947_0909996
258 Ga0395900_0007733
259 Ga0395900_0478794
260 Ga0395898_0086738
261 Ga0395898_0109155
262 Ga0395901_0173339
263 Ga0395901_0278445
264 Ga0395901_0748268
265 Ga0439464_0257098
266 Ga0466972_0117032
267 Ga0466972_0268295
268 Ga0466965_0129457
269 Ga0466965_0320278
270 Ga0466965_0458304
271 Ga0466966_0097309
272 Ga0466966_0214807
273 Ga0466966_0401185
274 Ga0466961_0033873
275 Ga0466961_0047384
276 Ga0466961_0051272
277 Ga0466961_0069329
278 Ga0466961_0076059
279 Ga0466961_0141315
280 Ga0466963_0011058
281 Ga0466963_0109847
282 Ga0466963_0148065
283 Ga0466963_0941543
284 Ga0466964_0159253
285 Ga0466971_0046257
286 Ga0466971_0061091
287 Ga0466971_0422945
288 Ga0466970_0079813
289 Ga0466970_0081197
290 Ga0466970_0091268
291 Ga0466957_0058457
292 Ga0466957_0079449
293 Ga0466957_0226260
294 Ga0466957_0275271
295 Ga0466957_1147208
296 Ga0466960_0011911
297 Ga0466960_0062932
298 Ga0466959_0057817
299 Ga0466959_0162126
300 Ga0466959_0246322
301 Ga0466959_0247262
302 Ga0466959_0583481
303 Ga0466958_0165731
304 Ga0466958_0846674
305 Ga0466967_0000899
306 Ga0466967_0028092
307 Ga0466967_0077997
308 Ga0466967_0098461
309 Ga0466967_0122623
310 Ga0466967_0233719
311 Ga0466967_1530870
312 Ga0495596_0060078
313 Ga0495631_0097130
314 Ga0495663_0021191
315 Ga0495598_0131250
316 Ga0495668_0367434
317 Ga0495661_0302614
318 Ga0495615_0076566
319 Ga0496111_0248732
320 Ga0501072_1242669
321 Ga0501045_0625143
322 Ga0500559_0005952
323 Ga0500616_0001353
324 Ga0466962_0171016
325 Ga0466962_0216898
326 Ga0466962_0377694
327 2623501668
328 2673163382
329 2676475775
330 2827630336

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08445

FR47

FR47-like protein

96

167

0.91

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

40

161

0.8

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

41

171

0.77

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

73

160

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fe7-assembly1.cif.gz_A the crystal structure of a probable n-acetyltransferase from pseudomonas aeruginosa 0.9668 1 161
2fe7-assembly1.cif.gz_B the crystal structure of a probable n-acetyltransferase from pseudomonas aeruginosa 0.9657 2 161
2fe7-assembly1.cif.gz_A the crystal structure of a probable n-acetyltransferase from pseudomonas aeruginosa 0.9608 1 161
2b3u-assembly1.cif.gz_B human spermine spermidine acetyltransferase k26r mutant 0.9165 1 160
2b5g-assembly1.cif.gz_B wild type ssat- 1.7a structure 0.9133 1 160
ID Description Score Start End Superfamily
af_Q54W72_6_169_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9752 2 162 3.40.630.30
2fe7A00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9668 1 161 3.40.630.30
2fe7A00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9608 1 161 3.40.630.30
af_A4ICI2_5_157_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9454 2 152 3.40.630.30
af_Q54W72_6_169_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9345 2 162 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A7J9V980-F1-model_v4 GNAT family N-acetyltransferase 0.9957 3 160 GO:0008080
AF-A0A5S4ZCN1-F1-model_v4 deleted 0.9944 2 164
AF-A0A2X4UF83-F1-model_v4 GNAT family acetyltransferase 0.9941 2 160 GO:0008080
AF-A0A1I1J6L9-F1-model_v4 L-amino acid N-acyltransferase YncA 0.9934 3 160 GO:0008080
AF-A0A7K2WG90-F1-model_v4 GNAT family N-acetyltransferase 0.9927 2 160 GO:0008080

Map