F246320

General Info

Members Datasets Scaffolds Average Seq Length
165 118 331 128

Family's Representative Sequence

Representative Sequence 3300025923|Ga0207681_10707577|Ga0207681_107075772
Length 137
Sequence MIVGIGTDVVSIERIAGVLERHGERFLDRILTADERKRFDRTKAKASHLAKRWAAKEAFSKAIGTGIHPPFTWKSIGVGRDPKGKPLVVPSAEMAKHLKKLGVTSAHVSLTDDAGVAVAFVVLEGPSPRPSPKVEGE

Samples

Sample ID Description Type Environment
1 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
78 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
79 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
80 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
81 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
85 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
86 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
87 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
88 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
89 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
93 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
94 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
95 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
96 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
97 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
98 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
99 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
100 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
101 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
102 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
103 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
104 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
105 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
106 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
107 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
108 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
109 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
110 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
111 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
112 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
113 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
114 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
115 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
116 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
117 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
118 2939615513 Lactococcus lactis 1925 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.18
Metatranscriptomes 0.61
Isolates 1.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.64
Nodule 0
Rhizoplane 1.21
Rhizosphere 90.3
Stem 0
Stem Tuber 0
Unclassified 1.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207681_10707577 3300025923 Bacteria 838
2 rootH1_10003663 3300003316 Bacteria 5166
3 rootH1_10003663 3300003323 Bacteria 4065
4 rootL2_10041967 3300003322 Bacteria 6527
5 Ga0070658_10082048 3300005327 Bacteria 2649
6 Ga0070658_11160164 3300005327 Bacteria 672
7 Ga0070658_11732155 3300005327 Bacteria 541
8 Ga0070677_10319592 3300005333 Bacteria 795
9 Ga0070666_10549364 3300005335 Bacteria 840
10 Ga0070682_100926180 3300005337 Bacteria 718
11 Ga0070660_100088332 3300005339 Bacteria 2441
12 Ga0070660_101840602 3300005339 Bacteria 516
13 Ga0070674_101915352 3300005356 Bacteria 539
14 Ga0070674_101968407 3300005356 Bacteria 532
15 Ga0070659_100122913 3300005366 Bacteria 2104
16 Ga0070659_101031799 3300005366 Bacteria 723
17 Ga0070714_100572575 3300005435 Bacteria 1083
18 Ga0070713_100461190 3300005436 Bacteria 1195
19 Ga0070701_10443218 3300005438 Bacteria 832
20 Ga0070700_100238205 3300005441 Bacteria 1299
21 Ga0070678_101810625 3300005456 Bacteria 576
22 Ga0068867_101743858 3300005459 Bacteria 585
23 Ga0070679_100637494 3300005530 Bacteria 1008
24 Ga0070679_101426092 3300005530 Bacteria 639
25 Ga0068853_100222888 3300005539 Bacteria 1723
26 Ga0070693_100139084 3300005547 Bacteria 1526
27 Ga0070665_100106333 3300005548 Bacteria 2808
28 Ga0070665_100439326 3300005548 Bacteria 1314
29 Ga0070704_101947623 3300005549 Unclassified 545
30 Ga0068855_100101884 3300005563 Bacteria 3305
31 Ga0068852_100011796 3300005616 Bacteria 6600
32 Ga0068852_100018662 3300005616 Bacteria 5467
33 Ga0068852_100399657 3300005616 Bacteria 1351
34 Ga0068852_100955239 3300005616 Bacteria 875
35 Ga0068851_10000495 3300005834 Bacteria 17225
36 Ga0068858_100119601 3300005842 Bacteria 2462
37 Ga0075367_10210746 3300006178 Bacteria 1215
38 Ga0075366_10013949 3300006195 Bacteria 4582
39 Ga0097621_100121155 3300006237 Bacteria 2219
40 Ga0068871_100127301 3300006358 Bacteria 2157
41 Ga0068871_100976545 3300006358 Bacteria 788
42 Ga0075428_100002620 3300006844 Bacteria 19578
43 Ga0105240_10075939 3300009093 Bacteria 4144
44 Ga0105240_10087390 3300009093 Bacteria 3818
45 Ga0111539_10003080 3300009094 Bacteria 22102
46 Ga0105245_11561929 3300009098 Bacteria 711
47 Ga0105243_10231915 3300009148 Bacteria 1638
48 Ga0105241_11809897 3300009174 Bacteria 596
49 Ga0105242_10033291 3300009176 Bacteria 4126
50 Ga0105248_10364041 3300009177 Bacteria 1628
51 Ga0105238_10008612 3300009551 Bacteria 10207
52 Ga0105238_10106933 3300009551 Bacteria 2779
53 Ga0105238_10808744 3300009551 Bacteria 953
54 Ga0105249_11108508 3300009553 Bacteria 862
55 Ga0157371_10060347 3300013102 Bacteria 2689
56 Ga0157371_10514583 3300013102 Bacteria 885
57 Ga0157370_10518386 3300013104 Bacteria 1094
58 Ga0157369_10003403 3300013105 Bacteria 18870
59 Ga0157374_11908698 3300013296 Bacteria 620
60 Ga0163162_10101404 3300013306 Bacteria 2970
61 Ga0157372_10004466 3300013307 Bacteria 14927
62 Ga0157372_11886227 3300013307 Bacteria 687
63 Ga0163163_13011012 3300014325 Bacteria 526
64 Ga0157380_10297915 3300014326 Bacteria 1484
65 Ga0206353_10426645 3300020082 Bacteria 571
66 Ga0213872_10001055 3300021361 Bacteria 19163
67 Ga0213872_10009682 3300021361 Bacteria 4611
68 Ga0213876_10058262 3300021384 Bacteria 2039
69 Ga0207656_10001486 3300025321 Bacteria 7759
70 Ga0207682_10039690 3300025893 Bacteria 1915
71 Ga0207705_10106089 3300025909 Bacteria 2072
72 Ga0207705_10617199 3300025909 Bacteria 843
73 Ga0207705_11396316 3300025909 Bacteria 532
74 Ga0207695_10056075 3300025913 Bacteria 4102
75 Ga0207660_10934618 3300025917 Bacteria 707
76 Ga0207657_10520640 3300025919 Bacteria 931
77 Ga0207649_10527409 3300025920 Bacteria 901
78 Ga0207652_10631565 3300025921 Bacteria 959
79 Ga0207694_10030422 3300025924 Bacteria 4123
80 Ga0207694_10174841 3300025924 Bacteria 1740
81 Ga0207694_10251331 3300025924 Bacteria 1447
82 Ga0207694_11812772 3300025924 Bacteria 513
83 Ga0207664_10296034 3300025929 Bacteria 1423
84 Ga0207690_10057929 3300025932 Bacteria 2619
85 Ga0207686_10008481 3300025934 Bacteria 5551
86 Ga0207709_10133948 3300025935 Bacteria 1693
87 Ga0207669_10037911 3300025937 Bacteria 2771
88 Ga0207669_10910982 3300025937 Bacteria 735
89 Ga0207704_10342590 3300025938 Bacteria 1161
90 Ga0207691_10671825 3300025940 Bacteria 874
91 Ga0207667_10030499 3300025949 Bacteria 5833
92 Ga0207667_10431480 3300025949 Bacteria 1340
93 Ga0207651_10408138 3300025960 Bacteria 1157
94 Ga0207677_10148573 3300026023 Bacteria 1804
95 Ga0207703_10034940 3300026035 Bacteria 3992
96 Ga0207639_10400372 3300026041 Bacteria 1236
97 Ga0207648_10215522 3300026089 Bacteria 1705
98 Ga0207648_10648292 3300026089 Bacteria 976
99 Ga0207648_11327265 3300026089 Bacteria 676
100 Ga0207683_10440239 3300026121 Bacteria 1201
101 Ga0207698_10001184 3300026142 Bacteria 15204
102 Ga0207698_10016718 3300026142 Bacteria 4956
103 Ga0207698_10154148 3300026142 Bacteria 1999
104 Ga0207698_10336360 3300026142 Bacteria 1420
105 Ga0207428_10006673 3300027907 Bacteria 10599
106 Ga0268266_10168210 3300028379 Bacteria 1988
107 Ga0307408_100121343 3300031548 Bacteria 2025
108 Ga0307408_101282897 3300031548 Bacteria 686
109 Ga0307408_101318427 3300031548 Bacteria 677
110 Ga0307405_10171567 3300031731 Bacteria 1548
111 Ga0307405_10956488 3300031731 Bacteria 728
112 Ga0307410_11014724 3300031852 Bacteria 716
113 Ga0307407_10750564 3300031903 Bacteria 739
114 Ga0307412_10164948 3300031911 Bacteria 1651
115 Ga0307412_10642191 3300031911 Bacteria 904
116 Ga0307412_11205581 3300031911 Bacteria 678
117 Ga0307412_11374945 3300031911 Bacteria 638
118 Ga0307409_101720933 3300031995 Bacteria 656
119 Ga0307416_100155609 3300032002 Bacteria 2104
120 Ga0307416_100606184 3300032002 Bacteria 1175
121 Ga0307416_102198540 3300032002 Bacteria 653
122 Ga0307416_102520228 3300032002 Unclassified 613
123 Ga0307411_10741310 3300032005 Bacteria 860
124 Ga0307411_10763698 3300032005 Bacteria 848
125 Ga0307415_101403703 3300032126 Bacteria 665
126 Ga0373928_0033691 3300035084 Bacteria 1146
127 Ga0373932_0457197 3300035112 Bacteria 502
128 Ga0373924_0041139 3300035410 Bacteria 1893
129 Ga0373937_0737024 3300036401 Bacteria 933
130 Ga0395900_0069957 3300037418 Bacteria 3608
131 Ga0436365_1049173 3300039437 Bacteria 5856
132 Ga0436361_0005164 3300039447 Bacteria 19094
133 Ga0436361_0319783 3300039447 Bacteria 14827
134 Ga0436361_0416839 3300039447 Bacteria 16352
135 Ga0451807_1397567 3300041486 Bacteria 509
136 Ga0451839_0817730 3300041496 Bacteria 600
137 Ga0451853_1076809 3300041512 Bacteria 685
138 Ga0439441_093458 3300042001 Bacteria 667
139 Ga0439435_0361949 3300042436 Bacteria 505
140 Ga0451577_0156399 3300042876 Bacteria 2052
141 Ga0451577_0676408 3300042876 Bacteria 935
142 Ga0451577_0800573 3300042876 Bacteria 851
143 Ga0453683_0654901 3300044673 Bacteria 687
144 Ga0466966_0035268 3300044684 Bacteria 3233
145 Ga0466961_0523685 3300044693 Bacteria 715
146 Ga0466971_0541272 3300044719 Bacteria 577
147 Ga0466957_0249149 3300044842 Bacteria 1181
148 Ga0451576_0002728 3300045051 Bacteria 25632
149 Ga0451576_0076793 3300045051 Bacteria 3476
150 Ga0466958_0006247 3300045836 Bacteria 6469
151 Ga0466967_0695638 3300045976 Bacteria 1007
152 Ga0495630_0473282 3300046517 Bacteria 960
153 Ga0496105_0413950 3300048908 Bacteria 1068
154 Ga0496117_0000040 3300048920 Bacteria 318616
155 Ga0501202_186385 3300049652 Bacteria 562
156 Ga0501217_157696 3300049661 Bacteria 683
157 nmdc:mga0k408_383402_c1 3300050493 Bacteria 837
158 nmdc:mga0k408_5448_c1 3300050493 Bacteria 6777
159 nmdc:mga0k408_742758_c1 3300050493 Bacteria 573
160 nmdc:mga06z11_115106_c1 3300050494 Bacteria 1493
161 nmdc:mga08y16_1184609_c1 3300050511 Bacteria 735
162 nmdc:mga08y16_86161_c1 3300050511 Bacteria 3274
163 Ga0501084_0830714 3300054114 Bacteria 778
164 Ga0466962_0079057 3300061719 Bacteria 1572
165 2526210574 2526164512 Bacteria 4025691
166 2939616698 2939615513 Bacteria 2384962
167 Ga0207681_10707577
168 rootH1_10003663
169 rootL2_10041967
170 Ga0070658_10082048
171 Ga0070658_11160164
172 Ga0070658_11732155
173 Ga0070677_10319592
174 Ga0070666_10549364
175 Ga0070682_100926180
176 Ga0070660_100088332
177 Ga0070660_101840602
178 Ga0070674_101915352
179 Ga0070674_101968407
180 Ga0070659_100122913
181 Ga0070659_101031799
182 Ga0070714_100572575
183 Ga0070713_100461190
184 Ga0070701_10443218
185 Ga0070700_100238205
186 Ga0070678_101810625
187 Ga0068867_101743858
188 Ga0070679_100637494
189 Ga0070679_101426092
190 Ga0068853_100222888
191 Ga0070693_100139084
192 Ga0070665_100106333
193 Ga0070665_100439326
194 Ga0070704_101947623
195 Ga0068855_100101884
196 Ga0068852_100011796
197 Ga0068852_100018662
198 Ga0068852_100399657
199 Ga0068852_100955239
200 Ga0068851_10000495
201 Ga0068858_100119601
202 Ga0075367_10210746
203 Ga0075366_10013949
204 Ga0097621_100121155
205 Ga0068871_100127301
206 Ga0068871_100976545
207 Ga0075428_100002620
208 Ga0105240_10075939
209 Ga0105240_10087390
210 Ga0111539_10003080
211 Ga0105245_11561929
212 Ga0105243_10231915
213 Ga0105241_11809897
214 Ga0105242_10033291
215 Ga0105248_10364041
216 Ga0105238_10008612
217 Ga0105238_10106933
218 Ga0105238_10808744
219 Ga0105249_11108508
220 Ga0157371_10060347
221 Ga0157371_10514583
222 Ga0157370_10518386
223 Ga0157369_10003403
224 Ga0157374_11908698
225 Ga0163162_10101404
226 Ga0157372_10004466
227 Ga0157372_11886227
228 Ga0163163_13011012
229 Ga0157380_10297915
230 Ga0206353_10426645
231 Ga0213872_10001055
232 Ga0213872_10009682
233 Ga0213876_10058262
234 Ga0207656_10001486
235 Ga0207682_10039690
236 Ga0207705_10106089
237 Ga0207705_10617199
238 Ga0207705_11396316
239 Ga0207695_10056075
240 Ga0207660_10934618
241 Ga0207657_10520640
242 Ga0207649_10527409
243 Ga0207652_10631565
244 Ga0207694_10030422
245 Ga0207694_10174841
246 Ga0207694_10251331
247 Ga0207694_11812772
248 Ga0207664_10296034
249 Ga0207690_10057929
250 Ga0207686_10008481
251 Ga0207709_10133948
252 Ga0207669_10037911
253 Ga0207669_10910982
254 Ga0207704_10342590
255 Ga0207691_10671825
256 Ga0207667_10030499
257 Ga0207667_10431480
258 Ga0207651_10408138
259 Ga0207677_10148573
260 Ga0207703_10034940
261 Ga0207639_10400372
262 Ga0207648_10215522
263 Ga0207648_10648292
264 Ga0207648_11327265
265 Ga0207683_10440239
266 Ga0207698_10001184
267 Ga0207698_10016718
268 Ga0207698_10154148
269 Ga0207698_10336360
270 Ga0207428_10006673
271 Ga0268266_10168210
272 Ga0307408_100121343
273 Ga0307408_101282897
274 Ga0307408_101318427
275 Ga0307405_10171567
276 Ga0307405_10956488
277 Ga0307410_11014724
278 Ga0307407_10750564
279 Ga0307412_10164948
280 Ga0307412_10642191
281 Ga0307412_11205581
282 Ga0307412_11374945
283 Ga0307409_101720933
284 Ga0307416_100155609
285 Ga0307416_100606184
286 Ga0307416_102198540
287 Ga0307416_102520228
288 Ga0307411_10741310
289 Ga0307411_10763698
290 Ga0307415_101403703
291 Ga0373928_0033691
292 Ga0373932_0457197
293 Ga0373924_0041139
294 Ga0373937_0737024
295 Ga0395900_0069957
296 Ga0436365_1049173
297 Ga0436361_0005164
298 Ga0436361_0319783
299 Ga0436361_0416839
300 Ga0451807_1397567
301 Ga0451839_0817730
302 Ga0451853_1076809
303 Ga0439441_093458
304 Ga0439435_0361949
305 Ga0451577_0156399
306 Ga0451577_0676408
307 Ga0451577_0800573
308 Ga0453683_0654901
309 Ga0466966_0035268
310 Ga0466961_0523685
311 Ga0466971_0541272
312 Ga0466957_0249149
313 Ga0451576_0002728
314 Ga0451576_0076793
315 Ga0466958_0006247
316 Ga0466967_0695638
317 Ga0495630_0473282
318 Ga0496105_0413950
319 Ga0496117_0000040
320 Ga0501202_186385
321 Ga0501217_157696
322 nmdc:mga0k408_383402_c1
323 nmdc:mga0k408_5448_c1
324 nmdc:mga0k408_742758_c1
325 nmdc:mga06z11_115106_c1
326 nmdc:mga08y16_1184609_c1
327 nmdc:mga08y16_86161_c1
328 Ga0501084_0830714
329 Ga0466962_0079057
330 2526210574
331 2939616698

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01648

ACPS

4'-phosphopantetheinyl transferase superfamily

4

121

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cmo-assembly1.cif.gz_B crystal structure of holo-[acyl-carrier-protein] synthase (acps) from neisseria meningitidis 0.9761 1 125
5cmo-assembly1.cif.gz_B crystal structure of holo-[acyl-carrier-protein] synthase (acps) from neisseria meningitidis 0.9685 1 125
5xu7-assembly1.cif.gz_C crystal structure of escherichia coli holo-[acyl-carrier-protein] synthase (acps) 0.9645 1 124
5xu7-assembly1.cif.gz_A crystal structure of escherichia coli holo-[acyl-carrier-protein] synthase (acps) 0.9602 1 124
5vcb-assembly5.cif.gz_U crystal structure of holo-(acyl-carrier-protein) synthase:holo(acyl-carrier-protein) complex from escherichia coli. 0.9581 1 124
ID Description Score Start End Superfamily
5cmoC00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.9813 1 125 3.90.470.20
5cmoC00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.9736 1 125 3.90.470.20
5xuhB00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.9562 1 124 3.90.470.20
5xuhB00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.9406 1 124 3.90.470.20
af_Q552R4_1_166_3.90.470.20 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.924 1 125 3.90.470.20
ID Description Score Start End GO Terms
AF-A0A809RK48-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9872 1 126 GO:0000287
GO:0005737
GO:0006633
GO:0008897
AF-Q820I1-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9854 1 125 GO:0000287
GO:0005737
GO:0006633
GO:0008897
AF-B6BUJ1-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9834 1 124 GO:0000287
GO:0005737
GO:0006633
GO:0008897
AF-Q9RQW2-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9828 1 125 GO:0000287
GO:0005737
GO:0006633
GO:0008897
AF-A0A7Y3NIU2-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9811 1 125 GO:0000287
GO:0005737
GO:0006633
GO:0008897

Map