F245732

General Info

Members Datasets Scaffolds Average Seq Length
165 127 164 110

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100063805|Ga0068863_1000638052
Length 115
Sequence MGFSMEKAFVAQRVAKKLFVTEAAVDGALAEASELMSEMLRARKDVNVSMVFADDVQIKMVEAIKALSEARTAMVAVHSELNEAKLRLGIRTKMNGMDKPLALSAETTTALREVG

Samples

Sample ID Description Type Environment
1 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
2 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
3 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
27 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
46 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
47 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
69 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
70 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
71 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
72 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
73 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
74 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
75 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
76 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
80 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
81 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
82 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
83 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
84 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
85 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
86 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
87 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
88 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
89 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
90 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
91 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
92 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
93 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
94 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
95 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
96 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
97 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
98 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
99 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
100 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
101 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
102 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
103 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
104 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
105 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
106 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
107 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
108 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
109 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
110 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
111 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
115 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
116 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
117 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
118 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
119 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
120 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
121 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
122 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
123 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
124 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
125 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.97
Metatranscriptomes 2.42
Isolates 0.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.58
Nodule 0
Rhizoplane 5.45
Rhizosphere 72.73
Stem 0
Stem Tuber 0
Unclassified 4.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055530_10004087 3300003791 Bacteria 7783
2 Ga0055531_10024019 3300003794 Bacteria 2264
3 Ga0065165_1000622 3300005262 Bacteria 51482
4 Ga0065165_1032347 3300005262 Bacteria 1641
5 Ga0065165_1038212 3300005262 Bacteria 1449
6 Ga0070676_11363173 3300005328 Bacteria 543
7 Ga0070675_100852989 3300005354 Unclassified 834
8 Ga0070671_100397482 3300005355 Bacteria 1179
9 Ga0070674_102230852 3300005356 Bacteria 500
10 Ga0070659_100975626 3300005366 Unclassified 743
11 Ga0070713_101563752 3300005436 Unclassified 640
12 Ga0070708_101016876 3300005445 Bacteria 777
13 Ga0070698_100269616 3300005471 Bacteria 1634
14 Ga0070684_100638420 3300005535 Bacteria 991
15 Ga0070684_101107819 3300005535 Bacteria 744
16 Ga0070665_100018345 3300005548 Bacteria 7014
17 Ga0070665_100868288 3300005548 Bacteria 915
18 Ga0068855_100066777 3300005563 Bacteria 4193
19 Ga0068856_100290095 3300005614 Bacteria 1653
20 Ga0068856_100549684 3300005614 Bacteria 1176
21 Ga0068852_101990281 3300005616 Unclassified 603
22 Ga0068864_101393169 3300005618 Unclassified 703
23 Ga0068866_10771242 3300005718 Bacteria 666
24 Ga0068861_100431496 3300005719 Bacteria 1176
25 Ga0068863_100063805 3300005841 Bacteria 3484
26 Ga0070717_10022359 3300006028 Bacteria 4995
27 Ga0075365_10445317 3300006038 Unclassified 914
28 Ga0075363_100051542 3300006048 Bacteria 2195
29 Ga0075364_11079157 3300006051 Bacteria 545
30 Ga0075362_10033704 3300006177 Bacteria 2228
31 Ga0075369_10053944 3300006186 Bacteria 1745
32 Ga0075369_10269537 3300006186 Bacteria 792
33 Ga0075366_10679646 3300006195 Bacteria 639
34 Ga0075370_10035458 3300006353 Bacteria 2800
35 Ga0068865_100000392 3300006881 Bacteria 24370
36 Ga0105240_10014348 3300009093 Bacteria 10820
37 Ga0105240_10561079 3300009093 Bacteria 1262
38 Ga0105240_11648522 3300009093 Bacteria 670
39 Ga0105243_12106997 3300009148 Unclassified 600
40 Ga0105241_11141153 3300009174 Unclassified 736
41 Ga0105248_10001210 3300009177 Bacteria 28848
42 Ga0105248_10692083 3300009177 Bacteria 1150
43 Ga0105237_10106788 3300009545 Bacteria 2792
44 Ga0105238_10170811 3300009551 Bacteria 2150
45 Ga0105249_10265891 3300009553 Bacteria 1706
46 Ga0105239_11102899 3300010375 Bacteria 914
47 Ga0105239_11339942 3300010375 Bacteria 826
48 Ga0105239_11620036 3300010375 Bacteria 749
49 Ga0157374_10568310 3300013296 Bacteria 1142
50 Ga0157374_12924915 3300013296 Bacteria 505
51 Ga0163162_10451440 3300013306 Bacteria 1417
52 Ga0163162_10755479 3300013306 Bacteria 1091
53 Ga0163162_11399729 3300013306 Bacteria 796
54 Ga0163162_12897100 3300013306 Unclassified 552
55 Ga0157375_11716327 3300013308 Bacteria 744
56 Ga0163163_10382895 3300014325 Bacteria 1464
57 Ga0157377_10429379 3300014745 Bacteria 907
58 Ga0157376_10351624 3300014969 Bacteria 1410
59 Ga0207425_1057924 3300025245 Unclassified 690
60 Ga0209758_1002206 3300025297 Bacteria 20321
61 Ga0209050_1000073 3300025298 Bacteria 292046
62 Ga0209256_1120339 3300025299 Bacteria 516
63 Ga0209257_1000099 3300025304 Bacteria 255304
64 Ga0207654_11429565 3300025911 Bacteria 504
65 Ga0207695_10001284 3300025913 Bacteria 42684
66 Ga0207695_10174665 3300025913 Bacteria 2071
67 Ga0207695_11126712 3300025913 Unclassified 665
68 Ga0207671_10073122 3300025914 Bacteria 2560
69 Ga0207694_10027929 3300025924 Bacteria 4300
70 Ga0207687_10813406 3300025927 Bacteria 797
71 Ga0207690_10764797 3300025932 Bacteria 797
72 Ga0207686_10593793 3300025934 Unclassified 871
73 Ga0207704_10017803 3300025938 Bacteria 3694
74 Ga0207704_10528096 3300025938 Bacteria 955
75 Ga0207711_10199945 3300025941 Bacteria 1823
76 Ga0207689_10696145 3300025942 Bacteria 857
77 Ga0207651_10567354 3300025960 Bacteria 989
78 Ga0207712_10105136 3300025961 Bacteria 2106
79 Ga0207703_10519841 3300026035 Bacteria 1119
80 Ga0207641_10111561 3300026088 Bacteria 2425
81 Ga0207641_10818011 3300026088 Bacteria 922
82 Ga0207676_10197271 3300026095 Bacteria 1776
83 Ga0207676_11572884 3300026095 Unclassified 655
84 Ga0207675_100415561 3300026118 Bacteria 1328
85 Ga0207698_11840936 3300026142 Unclassified 620
86 Ga0268266_10059944 3300028379 Bacteria 3279
87 Ga0268266_11251752 3300028379 Bacteria 717
88 Ga0307517_10002333 3300028786 Bacteria 30608
89 Ga0307517_10166552 3300028786 Unclassified 1462
90 Ga0307511_10009011 3300030521 Bacteria 9957
91 Ga0265327_10065863 3300031251 Bacteria 1830
92 Ga0307513_10000899 3300031456 Bacteria 42953
93 Ga0307513_10000983 3300031456 Bacteria 41242
94 Ga0307406_10618559 3300031901 Bacteria 895
95 Ga0307412_10757250 3300031911 Bacteria 839
96 Ga0373936_0006195 3300035113 Bacteria 4509
97 Ga0373955_0829229 3300035172 Unclassified 569
98 Ga0395899_0000052 3300037312 Bacteria 221643
99 Ga0395899_0660752 3300037312 Bacteria 659
100 Ga0395900_0000002 3300037418 Bacteria 671103
101 Ga0395898_0007023 3300037466 Bacteria 11965
102 Ga0395898_0300560 3300037466 Bacteria 1531
103 Ga0395905_0015206 3300037471 Bacteria 7319
104 Ga0395905_0235106 3300037471 Bacteria 1713
105 Ga0395905_0947225 3300037471 Bacteria 764
106 Ga0395901_0000013 3300038443 Bacteria 375733
107 Ga0451793_0254940 3300041452 Bacteria 778
108 Ga0451798_0564185 3300041458 Unclassified 788
109 Ga0451853_2547910 3300041512 Bacteria 720
110 Ga0466969_0305722 3300044656 Unclassified 720
111 Ga0495592_0768578 3300046454 Unclassified 574
112 Ga0495638_0279986 3300046460 Unclassified 907
113 Ga0495650_0103972 3300046471 Unclassified 1063
114 Ga0495628_0040127 3300046516 Bacteria 3742
115 Ga0495644_0167707 3300046523 Bacteria 843
116 Ga0495648_0129939 3300046524 Unclassified 1341
117 Ga0495663_0169147 3300046525 Unclassified 753
118 Ga0495621_0452648 3300046539 Unclassified 550
119 Ga0495597_0398192 3300046542 Unclassified 524
120 Ga0495645_0064877 3300046543 Bacteria 2642
121 Ga0495668_0031570 3300046616 Bacteria 2985
122 Ga0495668_0037756 3300046616 Bacteria 2702
123 Ga0495668_0074988 3300046616 Bacteria 1858
124 Ga0495668_0098796 3300046616 Bacteria 1597
125 Ga0495668_0113036 3300046616 Unclassified 1485
126 Ga0495625_0074976 3300046660 Bacteria 2368
127 Ga0495625_0169064 3300046660 Bacteria 1461
128 Ga0495625_0470291 3300046660 Bacteria 773
129 Ga0495659_0164277 3300046664 Unclassified 898
130 Ga0495588_0041193 3300046674 Bacteria 2358
131 Ga0495669_0036840 3300046684 Bacteria 2163
132 Ga0495636_0105894 3300047318 Bacteria 1233
133 Ga0495672_0015797 3300047320 Bacteria 5113
134 Ga0495672_0390963 3300047320 Bacteria 638
135 Ga0495677_0158301 3300047445 Unclassified 873
136 Ga0495677_0258161 3300047445 Unclassified 682
137 Ga0495686_0004562 3300047472 Bacteria 11341
138 Ga0496100_0260446 3300048903 Bacteria 1286
139 Ga0496100_0455867 3300048903 Bacteria 981
140 Ga0496101_1146892 3300048904 Bacteria 610
141 Ga0496109_1435873 3300048912 Unclassified 625
142 Ga0496110_1419814 3300048913 Unclassified 604
143 Ga0496113_1122619 3300048916 Bacteria 616
144 Ga0496115_1030366 3300048918 Unclassified 627
145 Ga0501299_041674 3300049522 Bacteria 923
146 Ga0501320_048173 3300049536 Bacteria 575
147 Ga0501329_11153 3300049545 Bacteria 570
148 Ga0501047_0913989 3300049581 Bacteria 691
149 Ga0501227_129199 3300049665 Bacteria 687
150 Ga0501241_077367 3300049758 Unclassified 688
151 nmdc:mga03683_571625_c1 3300050489 Bacteria 552
152 nmdc:mga03683_74769_c1 3300050489 Unclassified 1454
153 nmdc:mga03n38_202119_c1 3300050490 Unclassified 1029
154 nmdc:mga0yw44_168976_c1 3300050492 Unclassified 1435
155 nmdc:mga0k408_405216_c1 3300050493 Bacteria 811
156 nmdc:mga0k408_698489_c1 3300050493 Bacteria 594
157 nmdc:mga07m45_56268_c1 3300050496 Bacteria 2223
158 nmdc:mga0sz30_89387_c1 3300050516 Bacteria 1339
159 Ga0500650_0234559 3300053098 Bacteria 827
160 Ga0500557_231116 3300053105 Bacteria 585
161 Ga0500645_008467 3300053730 Bacteria 3511
162 Ga0587086_051180 3300059507 Unclassified 666
163 Ga0587108_003440 3300059653 Bacteria 1120
164 Ga0466962_0695711 3300061719 Bacteria 521

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005535 Ga0070684_100638420 Ga0070684_1006384201 94
2 3300013306 Ga0163162_10755479 Ga0163162_107554791 94
3 3300026095 Ga0207676_10197271 Ga0207676_101972713 94
4 3300041458 Ga0451798_0564185 Ga0451798_0564185_214_546 94
5 3300005618 Ga0068864_101393169 Ga0068864_1013931691 96
6 3300048912 Ga0496109_1435873 Ga0496109_1435873_150_482 96
7 3300035172 Ga0373955_0829229 Ga0373955_0829229_168_506 99
8 3300046454 Ga0495592_0768578 Ga0495592_0768578_183_521 99
9 3300046516 Ga0495628_0040127 Ga0495628_0040127_3094_3432 99
10 3300046543 Ga0495645_0064877 Ga0495645_0064877_719_1057 99
11 3300049581 Ga0501047_0913989 Ga0501047_0913989_18_329 102
12 3300005328 Ga0070676_11363173 Ga0070676_113631731 103
13 3300005719 Ga0068861_100431496 Ga0068861_1004314962 103
14 3300006186 Ga0075369_10269537 Ga0075369_102695371 103
15 3300026118 Ga0207675_100415561 Ga0207675_1004155612 103
16 3300028379 Ga0268266_11251752 Ga0268266_112517522 103
17 3300013306 Ga0163162_12897100 Ga0163162_128971001 104
18 3300037471 Ga0395905_0235106 Ga0395905_0235106_1091_1426 104
19 iso_pu_bacteria 2643221598 2644001743 107
20 3300005535 Ga0070684_101107819 Ga0070684_1011078191 109
21 3300005563 Ga0068855_100066777 Ga0068855_1000667772 109
22 3300005614 Ga0068856_100549684 Ga0068856_1005496841 109
23 3300005616 Ga0068852_101990281 Ga0068852_1019902811 109
24 3300009093 Ga0105240_10561079 Ga0105240_105610793 109
25 3300009148 Ga0105243_12106997 Ga0105243_121069971 109
26 3300009545 Ga0105237_10106788 Ga0105237_101067882 109
27 3300009551 Ga0105238_10170811 Ga0105238_101708112 109
28 3300025913 Ga0207695_11126712 Ga0207695_111267121 109
29 3300025914 Ga0207671_10073122 Ga0207671_100731222 109
30 3300025924 Ga0207694_10027929 Ga0207694_100279292 109
31 3300025960 Ga0207651_10567354 Ga0207651_105673542 109
32 3300026142 Ga0207698_11840936 Ga0207698_118409361 109
33 3300046542 Ga0495597_0398192 Ga0495597_0398192_173_502 109
34 3300005436 Ga0070713_101563752 Ga0070713_1015637521 110
35 3300005445 Ga0070708_101016876 Ga0070708_1010168761 110
36 3300005614 Ga0068856_100290095 Ga0068856_1002900953 110
37 3300006028 Ga0070717_10022359 Ga0070717_100223592 110
38 3300009093 Ga0105240_10014348 Ga0105240_100143489 110
39 3300009093 Ga0105240_11648522 Ga0105240_116485221 110
40 3300009177 Ga0105248_10001210 Ga0105248_1000121025 110
41 3300010375 Ga0105239_11339942 Ga0105239_113399421 110
42 3300025911 Ga0207654_11429565 Ga0207654_114295651 110
43 3300025913 Ga0207695_10001284 Ga0207695_100012844 110
44 3300025941 Ga0207711_10199945 Ga0207711_101999452 110
45 3300025942 Ga0207689_10696145 Ga0207689_106961451 110
46 3300026035 Ga0207703_10519841 Ga0207703_105198412 110
47 3300037312 Ga0395899_0660752 Ga0395899_0660752_96_428 110
48 3300037466 Ga0395898_0300560 Ga0395898_0300560_762_1094 110
49 3300048903 Ga0496100_0455867 Ga0496100_0455867_634_966 110
50 3300048916 Ga0496113_1122619 Ga0496113_1122619_156_488 110
51 3300048918 Ga0496115_1030366 Ga0496115_1030366_93_425 110
52 3300049522 Ga0501299_041674 Ga0501299_041674_149_481 110
53 3300049665 Ga0501227_129199 Ga0501227_129199_192_524 110
54 3300003791 Ga0055530_10004087 Ga0055530_100040877 111
55 3300003794 Ga0055531_10024019 Ga0055531_100240192 111
56 3300005262 Ga0065165_1000622 Ga0065165_100062220 111
57 3300005262 Ga0065165_1032347 Ga0065165_10323472 111
58 3300005262 Ga0065165_1038212 Ga0065165_10382122 111
59 3300005354 Ga0070675_100852989 Ga0070675_1008529892 111
60 3300005355 Ga0070671_100397482 Ga0070671_1003974822 111
61 3300005356 Ga0070674_102230852 Ga0070674_1022308521 111
62 3300005366 Ga0070659_100975626 Ga0070659_1009756261 111
63 3300005471 Ga0070698_100269616 Ga0070698_1002696162 111
64 3300005548 Ga0070665_100018345 Ga0070665_1000183455 111
65 3300005548 Ga0070665_100868288 Ga0070665_1008682881 111
66 3300005718 Ga0068866_10771242 Ga0068866_107712422 111
67 3300005841 Ga0068863_100063805 Ga0068863_1000638052 111
68 3300006038 Ga0075365_10445317 Ga0075365_104453172 111
69 3300006048 Ga0075363_100051542 Ga0075363_1000515422 111
70 3300006051 Ga0075364_11079157 Ga0075364_110791571 111
71 3300006177 Ga0075362_10033704 Ga0075362_100337041 111
72 3300006186 Ga0075369_10053944 Ga0075369_100539442 111
73 3300006195 Ga0075366_10679646 Ga0075366_106796461 111
74 3300006353 Ga0075370_10035458 Ga0075370_100354582 111
75 3300006881 Ga0068865_100000392 Ga0068865_1000003926 111
76 3300009174 Ga0105241_11141153 Ga0105241_111411532 111
77 3300009177 Ga0105248_10692083 Ga0105248_106920832 111
78 3300009553 Ga0105249_10265891 Ga0105249_102658912 111
79 3300010375 Ga0105239_11102899 Ga0105239_111028991 111
80 3300010375 Ga0105239_11620036 Ga0105239_116200361 111
81 3300013296 Ga0157374_10568310 Ga0157374_105683102 111
82 3300013296 Ga0157374_12924915 Ga0157374_129249151 111
83 3300013306 Ga0163162_10451440 Ga0163162_104514402 111
84 3300013306 Ga0163162_11399729 Ga0163162_113997292 111
85 3300013308 Ga0157375_11716327 Ga0157375_117163272 111
86 3300014325 Ga0163163_10382895 Ga0163163_103828952 111
87 3300014745 Ga0157377_10429379 Ga0157377_104293791 111
88 3300014969 Ga0157376_10351624 Ga0157376_103516242 111
89 3300025245 Ga0207425_1057924 Ga0207425_10579241 111
90 3300025297 Ga0209758_1002206 Ga0209758_100220617 111
91 3300025298 Ga0209050_1000073 Ga0209050_1000073196 111
92 3300025299 Ga0209256_1120339 Ga0209256_11203391 111
93 3300025304 Ga0209257_1000099 Ga0209257_1000099100 111
94 3300025913 Ga0207695_10174665 Ga0207695_101746653 111
95 3300025927 Ga0207687_10813406 Ga0207687_108134062 111
96 3300025932 Ga0207690_10764797 Ga0207690_107647972 111
97 3300025934 Ga0207686_10593793 Ga0207686_105937931 111
98 3300025938 Ga0207704_10017803 Ga0207704_100178032 111
99 3300025938 Ga0207704_10528096 Ga0207704_105280961 111
100 3300025961 Ga0207712_10105136 Ga0207712_101051362 111
101 3300026088 Ga0207641_10111561 Ga0207641_101115613 111
102 3300026088 Ga0207641_10818011 Ga0207641_108180112 111
103 3300026095 Ga0207676_11572884 Ga0207676_115728841 111
104 3300028379 Ga0268266_10059944 Ga0268266_100599443 111
105 3300028786 Ga0307517_10002333 Ga0307517_1000233314 111
106 3300028786 Ga0307517_10166552 Ga0307517_101665522 111
107 3300030521 Ga0307511_10009011 Ga0307511_100090118 111
108 3300031251 Ga0265327_10065863 Ga0265327_100658632 111
109 3300031456 Ga0307513_10000899 Ga0307513_1000089911 111
110 3300031456 Ga0307513_10000983 Ga0307513_100009833 111
111 3300031901 Ga0307406_10618559 Ga0307406_106185592 111
112 3300031911 Ga0307412_10757250 Ga0307412_107572502 111
113 3300035113 Ga0373936_0006195 Ga0373936_0006195_3646_3981 111
114 3300037312 Ga0395899_0000052 Ga0395899_0000052_162547_162882 111
115 3300037418 Ga0395900_0000002 Ga0395900_0000002_539585_539920 111
116 3300037466 Ga0395898_0007023 Ga0395898_0007023_544_879 111
117 3300037471 Ga0395905_0015206 Ga0395905_0015206_544_879 111
118 3300037471 Ga0395905_0947225 Ga0395905_0947225_162_500 111
119 3300038443 Ga0395901_0000013 Ga0395901_0000013_163865_164200 111
120 3300041452 Ga0451793_0254940 Ga0451793_0254940_301_636 111
121 3300041512 Ga0451853_2547910 Ga0451853_2547910_91_426 111
122 3300044656 Ga0466969_0305722 Ga0466969_0305722_362_697 111
123 3300046460 Ga0495638_0279986 Ga0495638_0279986_462_797 111
124 3300046471 Ga0495650_0103972 Ga0495650_0103972_537_872 111
125 3300046523 Ga0495644_0167707 Ga0495644_0167707_266_601 111
126 3300046524 Ga0495648_0129939 Ga0495648_0129939_465_800 111
127 3300046525 Ga0495663_0169147 Ga0495663_0169147_49_384 111
128 3300046539 Ga0495621_0452648 Ga0495621_0452648_174_509 111
129 3300046616 Ga0495668_0031570 Ga0495668_0031570_1307_1642 111
130 3300046616 Ga0495668_0037756 Ga0495668_0037756_2306_2641 111
131 3300046616 Ga0495668_0074988 Ga0495668_0074988_178_513 111
132 3300046616 Ga0495668_0098796 Ga0495668_0098796_455_790 111
133 3300046616 Ga0495668_0113036 Ga0495668_0113036_368_703 111
134 3300046660 Ga0495625_0074976 Ga0495625_0074976_1981_2316 111
135 3300046660 Ga0495625_0169064 Ga0495625_0169064_72_407 111
136 3300046660 Ga0495625_0470291 Ga0495625_0470291_305_640 111
137 3300046664 Ga0495659_0164277 Ga0495659_0164277_109_447 111
138 3300046674 Ga0495588_0041193 Ga0495588_0041193_1795_2130 111
139 3300046684 Ga0495669_0036840 Ga0495669_0036840_1670_2005 111
140 3300047318 Ga0495636_0105894 Ga0495636_0105894_882_1220 111
141 3300047320 Ga0495672_0015797 Ga0495672_0015797_2988_3323 111
142 3300047320 Ga0495672_0390963 Ga0495672_0390963_156_491 111
143 3300047445 Ga0495677_0158301 Ga0495677_0158301_304_639 111
144 3300047445 Ga0495677_0258161 Ga0495677_0258161_308_643 111
145 3300047472 Ga0495686_0004562 Ga0495686_0004562_9131_9466 111
146 3300048903 Ga0496100_0260446 Ga0496100_0260446_88_423 111
147 3300048904 Ga0496101_1146892 Ga0496101_1146892_127_462 111
148 3300048913 Ga0496110_1419814 Ga0496110_1419814_15_350 111
149 3300049536 Ga0501320_048173 Ga0501320_048173_221_559 111
150 3300049545 Ga0501329_11153 Ga0501329_11153_21_359 111
151 3300049758 Ga0501241_077367 Ga0501241_077367_313_648 111
152 3300050489 nmdc:mga03683_571625_c1 nmdc:mga03683_571625_c1_120_458 111
153 3300050489 nmdc:mga03683_74769_c1 nmdc:mga03683_74769_c1_120_455 111
154 3300050490 nmdc:mga03n38_202119_c1 nmdc:mga03n38_202119_c1_128_466 111
155 3300050492 nmdc:mga0yw44_168976_c1 nmdc:mga0yw44_168976_c1_453_788 111
156 3300050493 nmdc:mga0k408_405216_c1 nmdc:mga0k408_405216_c1_379_714 111
157 3300050493 nmdc:mga0k408_698489_c1 nmdc:mga0k408_698489_c1_65_400 111
158 3300050496 nmdc:mga07m45_56268_c1 nmdc:mga07m45_56268_c1_473_808 111
159 3300050516 nmdc:mga0sz30_89387_c1 nmdc:mga0sz30_89387_c1_693_1028 111
160 3300053098 Ga0500650_0234559 Ga0500650_0234559_159_494 111
161 3300053105 Ga0500557_231116 Ga0500557_231116_29_367 111
162 3300053730 Ga0500645_008467 Ga0500645_008467_2058_2393 111
163 3300059507 Ga0587086_051180 Ga0587086_051180_86_421 111
164 3300059653 Ga0587108_003440 Ga0587108_003440_693_1028 111
165 3300061719 Ga0466962_0695711 Ga0466962_0695711_32_367 111

Feature Viewer

pLDDT pTM Quality
67.79 0.42 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map