F245484

General Info

Members Datasets Scaffolds Average Seq Length
165 124 330 205

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_100334811|Ga0070675_1003348112
Length 241
Sequence MNGTTIATEHEQEGALFTMKTLALTAVLTGAMLAGGCATKKFVRNTSAPIQAKVDQVGEQTNRNTAGLEDTRKELKGVDERAESGISAAKERALRSDKNSTELASLRGIVSNIDDYKLATETAVLFGLGKDKLTPEAKEALDKLATDKGNLKRFVVAVEGYTDKTGTPELNAALSKRRADAVVNYLVTKHDIPLYRIYTVGLGAEKPAEEGNTRAARTKNRRVEVKIFSADLNTTSASASR

Samples

Sample ID Description Type Environment
1 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
13 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
17 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009835 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample B Metatranscriptome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
42 3300019176 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
43 3300019182 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
44 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
48 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
52 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300023552 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
54 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300031043 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
73 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
74 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
75 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
76 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
77 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
78 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
79 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
82 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
83 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
84 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
85 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
86 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
87 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
88 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
89 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
90 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
91 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
92 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
93 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
94 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
95 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
96 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
97 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
98 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
99 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
100 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
101 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
102 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
103 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
104 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
105 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
106 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
107 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
108 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
109 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
110 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
111 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
112 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
113 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
114 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
115 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
116 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.55
Metatranscriptomes 25.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 97.58
Stem 0
Stem Tuber 0
Unclassified 43.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070675_100334811 3300005354 Bacteria 1340
2 Ga0058859_10034620 3300004798 Unclassified 1029
3 Ga0058862_12887834 3300004803 Unclassified 1566
4 Ga0065707_10210372 3300005295 Unclassified 1256
5 Ga0070680_100234430 3300005336 Bacteria 1550
6 Ga0070689_100076040 3300005340 Bacteria 2630
7 Ga0070689_100291902 3300005340 Unclassified 1355
8 Ga0070688_100013179 3300005365 Unclassified 4655
9 Ga0070681_10299434 3300005458 Bacteria 1518
10 Ga0070698_100759658 3300005471 Unclassified 913
11 Ga0070699_100023889 3300005518 Bacteria 5269
12 Ga0070679_100179966 3300005530 Bacteria 2087
13 Ga0070679_100410216 3300005530 Bacteria 1300
14 Ga0070695_100441483 3300005545 Bacteria 995
15 Ga0070696_100013113 3300005546 Bacteria 5560
16 Ga0070665_100407780 3300005548 Unclassified 1367
17 Ga0070665_100531479 3300005548 Bacteria 1188
18 Ga0068857_100327121 3300005577 Unclassified 1416
19 Ga0068857_100393916 3300005577 Bacteria 1288
20 Ga0068861_100071299 3300005719 Unclassified 2693
21 Ga0068870_10300336 3300005840 Unclassified 1013
22 Ga0068858_100298325 3300005842 Bacteria 1537
23 Ga0070717_10012109 3300006028 Bacteria 6572
24 Ga0097621_100502354 3300006237 Unclassified 1098
25 Ga0068871_100759476 3300006358 Unclassified 892
26 Ga0075428_100000811 3300006844 Bacteria 32679
27 Ga0075430_100374803 3300006846 Bacteria 1175
28 Ga0075431_100003979 3300006847 Bacteria 14406
29 Ga0075433_10114740 3300006852 Unclassified 2390
30 Ga0075433_10184895 3300006852 Archaea 1854
31 Ga0075433_10231005 3300006852 Bacteria 1643
32 Ga0075434_100112511 3300006871 Unclassified 2734
33 Ga0075429_100114290 3300006880 Unclassified 2360
34 Ga0075435_100282047 3300007076 Unclassified 1418
35 Ga0111539_10425560 3300009094 Bacteria 1546
36 Ga0114129_10069295 3300009147 Bacteria 4916
37 Ga0114129_10169628 3300009147 Bacteria 2976
38 Ga0105241_10354159 3300009174 Bacteria 1275
39 Ga0105237_10015949 3300009545 Bacteria 7811
40 Ga0130084_1052066 3300009835 Unclassified 810
41 Ga0105239_10102710 3300010375 Bacteria 3164
42 Ga0105239_10224420 3300010375 Bacteria 2107
43 Ga0157370_10151228 3300013104 Bacteria 2160
44 Ga0157369_10093865 3300013105 Bacteria 3203
45 Ga0157374_10135311 3300013296 Unclassified 2388
46 Ga0157374_10372358 3300013296 Unclassified 1422
47 Ga0157372_10373447 3300013307 Bacteria 1662
48 Ga0163163_10169587 3300014325 Bacteria 2229
49 Ga0163163_10191274 3300014325 Unclassified 2095
50 Ga0157379_10116462 3300014968 Bacteria 2403
51 Ga0163161_10646181 3300017792 Unclassified 876
52 Ga0184596_117004 3300019176 Unclassified 905
53 Ga0184598_117798 3300019182 Unclassified 984
54 Ga0197907_10084343 3300020069 Bacteria 2098
55 Ga0197907_10619542 3300020069 Unclassified 934
56 Ga0206356_11591251 3300020070 Unclassified 1113
57 Ga0206349_1228012 3300020075 Unclassified 1045
58 Ga0206349_1281644 3300020075 Unclassified 1059
59 Ga0206355_1397084 3300020076 Unclassified 1087
60 Ga0206352_10107403 3300020078 Unclassified 1107
61 Ga0206352_11261089 3300020078 Bacteria 921
62 Ga0206354_10056325 3300020081 Unclassified 924
63 Ga0206354_11689741 3300020081 Bacteria 935
64 Ga0206353_10243724 3300020082 Unclassified 1228
65 Ga0206353_10785721 3300020082 Bacteria 880
66 Ga0206353_11055237 3300020082 Bacteria 1307
67 Ga0213875_10007712 3300021388 Bacteria 5541
68 Ga0224712_10040098 3300022467 Unclassified 1760
69 Ga0224712_10085295 3300022467 Unclassified 1312
70 Ga0247551_100243 3300023552 Bacteria 1382
71 Ga0207692_10344982 3300025898 Unclassified 917
72 Ga0207680_10388595 3300025903 Bacteria 985
73 Ga0207707_10234722 3300025912 Bacteria 1596
74 Ga0207695_10123821 3300025913 Unclassified 2550
75 Ga0207671_10078872 3300025914 Unclassified 2467
76 Ga0207659_10058212 3300025926 Bacteria 2774
77 Ga0207711_10169364 3300025941 Bacteria 1981
78 Ga0207661_10125960 3300025944 Bacteria 2188
79 Ga0207703_10194000 3300026035 Bacteria 1801
80 Ga0207674_10370024 3300026116 Bacteria 1385
81 Ga0207675_100298400 3300026118 Bacteria 1569
82 Ga0207683_10551508 3300026121 Unclassified 1066
83 Ga0207428_10063208 3300027907 Unclassified 2925
84 Ga0268266_10526771 3300028379 Bacteria 1130
85 Ga0265777_103842 3300030877 Bacteria 939
86 Ga0265771_1002377 3300031010 Unclassified 998
87 Ga0265779_102019 3300031043 Unclassified 949
88 Ga0265760_10063804 3300031090 Bacteria 1123
89 Ga0265331_10087280 3300031250 Unclassified 1445
90 Ga0265316_10008051 3300031344 Bacteria 9835
91 Ga0265314_10113126 3300031711 Bacteria 1721
92 Ga0265342_10132578 3300031712 Bacteria 1395
93 Ga0373933_0163529 3300035724 Unclassified 1414
94 Ga0373947_0087779 3300035725 Bacteria 1935
95 Ga0373937_0278979 3300036401 Bacteria 1578
96 Ga0373937_0938767 3300036401 Bacteria 814
97 Ga0265778_004555 3300036457 Unclassified 1437
98 Ga0265778_011751 3300036457 Bacteria 1011
99 Ga0265778_019043 3300036457 Unclassified 838
100 Ga0265778_019457 3300036457 Unclassified 830
101 Ga0373925_0162520 3300037068 Unclassified 1760
102 Ga0436364_0512648 3300037853 Bacteria 7069
103 Ga0436365_1186620 3300039437 Unclassified 2298
104 Ga0453683_0037233 3300044673 Bacteria 3061
105 Ga0451576_0411343 3300045051 Unclassified 1419
106 Ga0495592_0150749 3300046454 Bacteria 1608
107 Ga0495629_0111318 3300046459 Bacteria 1909
108 Ga0495651_0016671 3300046462 Bacteria 5690
109 Ga0495651_0367613 3300046462 Unclassified 946
110 Ga0495580_0228532 3300046472 Bacteria 1278
111 Ga0495580_0298855 3300046472 Unclassified 1096
112 Ga0495582_0417670 3300046473 Unclassified 774
113 Ga0495662_0017349 3300046476 Bacteria 3484
114 Ga0495608_0184780 3300046511 Bacteria 1318
115 Ga0495608_0316075 3300046511 Bacteria 965
116 Ga0495618_0281470 3300046514 Bacteria 1037
117 Ga0495628_0006867 3300046516 Bacteria 9894
118 Ga0495652_0021967 3300046529 Bacteria 5671
119 Ga0495652_0300817 3300046529 Unclassified 1166
120 Ga0495652_0346929 3300046529 Unclassified 1065
121 Ga0495640_0056494 3300046533 Bacteria 2682
122 Ga0495587_0046672 3300046536 Bacteria 2570
123 Ga0495587_0090873 3300046536 Bacteria 1764
124 Ga0495645_0004311 3300046543 Bacteria 9720
125 Ga0495667_0011508 3300046559 Bacteria 5989
126 Ga0495667_0018574 3300046559 Bacteria 4695
127 Ga0495667_0348156 3300046559 Bacteria 936
128 Ga0495634_0218493 3300046642 Bacteria 1177
129 Ga0495635_0019220 3300046663 Bacteria 4766
130 Ga0495635_0373523 3300046663 Unclassified 949
131 Ga0495657_0194566 3300046675 Bacteria 1238
132 Ga0495623_0032409 3300046679 Unclassified 3359
133 Ga0495613_0208316 3300046689 Bacteria 1376
134 Ga0495604_0101034 3300047317 Bacteria 2119
135 Ga0495680_0199381 3300047322 Bacteria 1436
136 Ga0495675_0172868 3300047444 Bacteria 1326
137 Ga0495684_0002566 3300047471 Bacteria 14443
138 Ga0495684_0016082 3300047471 Bacteria 5759
139 Ga0495684_0017051 3300047471 Bacteria 5594
140 Ga0495684_0093778 3300047471 Bacteria 2273
141 Ga0495602_0026214 3300048088 Bacteria 5625
142 Ga0495602_0158667 3300048088 Bacteria 1769
143 nmdc:mga05p37_352659_c1 3300050507 Bacteria 1732
144 nmdc:mga05p37_540926_c1 3300050507 Bacteria 1328
145 nmdc:mga06r32_4480_c1 3300050510 Bacteria 12511
146 nmdc:mga08y16_49847_c1 3300050511 Bacteria 4381
147 nmdc:mga0n895_101137_c1 3300050512 Unclassified 2892
148 nmdc:mga0rr50_428057_c1 3300050513 Bacteria 1120
149 nmdc:mga0rr50_577110_c1 3300050513 Unclassified 958
150 nmdc:mga0a205_336336_c1 3300050515 Unclassified 1379
151 nmdc:mga0a205_363999_c1 3300050515 Unclassified 1312
152 Ga0495619_0076238 3300053085 Bacteria 2251
153 Ga0587084_020036 3300059477 Unclassified 991
154 Ga0587084_021051 3300059477 Unclassified 975
155 Ga0587073_0033706 3300059492 Unclassified 1075
156 Ga0587073_0082295 3300059492 Bacteria 801
157 Ga0587082_019299 3300059504 Unclassified 1094
158 Ga0587083_0038445 3300059505 Unclassified 990
159 Ga0587086_020888 3300059507 Unclassified 893
160 Ga0587098_019075 3300059604 Unclassified 855
161 Ga0587115_020669 3300059626 Unclassified 915
162 Ga0587128_014556 3300059630 Unclassified 1128
163 Ga0587128_026204 3300059630 Unclassified 934
164 Ga0587076_015574 3300059645 Unclassified 1187
165 Ga0587076_034607 3300059645 Unclassified 914
166 Ga0070675_100334811
167 Ga0058859_10034620
168 Ga0058862_12887834
169 Ga0065707_10210372
170 Ga0070680_100234430
171 Ga0070689_100076040
172 Ga0070689_100291902
173 Ga0070688_100013179
174 Ga0070681_10299434
175 Ga0070698_100759658
176 Ga0070699_100023889
177 Ga0070679_100179966
178 Ga0070679_100410216
179 Ga0070695_100441483
180 Ga0070696_100013113
181 Ga0070665_100407780
182 Ga0070665_100531479
183 Ga0068857_100327121
184 Ga0068857_100393916
185 Ga0068861_100071299
186 Ga0068870_10300336
187 Ga0068858_100298325
188 Ga0070717_10012109
189 Ga0097621_100502354
190 Ga0068871_100759476
191 Ga0075428_100000811
192 Ga0075430_100374803
193 Ga0075431_100003979
194 Ga0075433_10114740
195 Ga0075433_10184895
196 Ga0075433_10231005
197 Ga0075434_100112511
198 Ga0075429_100114290
199 Ga0075435_100282047
200 Ga0111539_10425560
201 Ga0114129_10069295
202 Ga0114129_10169628
203 Ga0105241_10354159
204 Ga0105237_10015949
205 Ga0130084_1052066
206 Ga0105239_10102710
207 Ga0105239_10224420
208 Ga0157370_10151228
209 Ga0157369_10093865
210 Ga0157374_10135311
211 Ga0157374_10372358
212 Ga0157372_10373447
213 Ga0163163_10169587
214 Ga0163163_10191274
215 Ga0157379_10116462
216 Ga0163161_10646181
217 Ga0184596_117004
218 Ga0184598_117798
219 Ga0197907_10084343
220 Ga0197907_10619542
221 Ga0206356_11591251
222 Ga0206349_1228012
223 Ga0206349_1281644
224 Ga0206355_1397084
225 Ga0206352_10107403
226 Ga0206352_11261089
227 Ga0206354_10056325
228 Ga0206354_11689741
229 Ga0206353_10243724
230 Ga0206353_10785721
231 Ga0206353_11055237
232 Ga0213875_10007712
233 Ga0224712_10040098
234 Ga0224712_10085295
235 Ga0247551_100243
236 Ga0207692_10344982
237 Ga0207680_10388595
238 Ga0207707_10234722
239 Ga0207695_10123821
240 Ga0207671_10078872
241 Ga0207659_10058212
242 Ga0207711_10169364
243 Ga0207661_10125960
244 Ga0207703_10194000
245 Ga0207674_10370024
246 Ga0207675_100298400
247 Ga0207683_10551508
248 Ga0207428_10063208
249 Ga0268266_10526771
250 Ga0265777_103842
251 Ga0265771_1002377
252 Ga0265779_102019
253 Ga0265760_10063804
254 Ga0265331_10087280
255 Ga0265316_10008051
256 Ga0265314_10113126
257 Ga0265342_10132578
258 Ga0373933_0163529
259 Ga0373947_0087779
260 Ga0373937_0278979
261 Ga0373937_0938767
262 Ga0265778_004555
263 Ga0265778_011751
264 Ga0265778_019043
265 Ga0265778_019457
266 Ga0373925_0162520
267 Ga0436364_0512648
268 Ga0436365_1186620
269 Ga0453683_0037233
270 Ga0451576_0411343
271 Ga0495592_0150749
272 Ga0495629_0111318
273 Ga0495651_0016671
274 Ga0495651_0367613
275 Ga0495580_0228532
276 Ga0495580_0298855
277 Ga0495582_0417670
278 Ga0495662_0017349
279 Ga0495608_0184780
280 Ga0495608_0316075
281 Ga0495618_0281470
282 Ga0495628_0006867
283 Ga0495652_0021967
284 Ga0495652_0300817
285 Ga0495652_0346929
286 Ga0495640_0056494
287 Ga0495587_0046672
288 Ga0495587_0090873
289 Ga0495645_0004311
290 Ga0495667_0011508
291 Ga0495667_0018574
292 Ga0495667_0348156
293 Ga0495634_0218493
294 Ga0495635_0019220
295 Ga0495635_0373523
296 Ga0495657_0194566
297 Ga0495623_0032409
298 Ga0495613_0208316
299 Ga0495604_0101034
300 Ga0495680_0199381
301 Ga0495675_0172868
302 Ga0495684_0002566
303 Ga0495684_0016082
304 Ga0495684_0017051
305 Ga0495684_0093778
306 Ga0495602_0026214
307 Ga0495602_0158667
308 nmdc:mga05p37_352659_c1
309 nmdc:mga05p37_540926_c1
310 nmdc:mga06r32_4480_c1
311 nmdc:mga08y16_49847_c1
312 nmdc:mga0n895_101137_c1
313 nmdc:mga0rr50_428057_c1
314 nmdc:mga0rr50_577110_c1
315 nmdc:mga0a205_336336_c1
316 nmdc:mga0a205_363999_c1
317 Ga0495619_0076238
318 Ga0587084_020036
319 Ga0587084_021051
320 Ga0587073_0033706
321 Ga0587073_0082295
322 Ga0587082_019299
323 Ga0587083_0038445
324 Ga0587086_020888
325 Ga0587098_019075
326 Ga0587115_020669
327 Ga0587128_014556
328 Ga0587128_026204
329 Ga0587076_015574
330 Ga0587076_034607

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00691

OmpA

OmpA family

125

221

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5u1h-assembly3.cif.gz_C crystal structure of the c-terminal peptidoglycan binding domain of oprf (pa1777) from pseudomonas aeruginosa 0.9319 102 211
4g88-assembly4.cif.gz_G crystal structure of ompa peptidoglycan-binding domain from acinetobacter baumannii 0.9306 102 211
4g4x-assembly1.cif.gz_A crystal structure of peptidoglycan-associated lipoprotein from acinetobacter baumannii 0.9198 105 209
5n2c-assembly1.cif.gz_A crystal structure of the peptidoglycan-associated lipoprotein from burkholderia cenocepacia 0.9154 105 209
5eb1-assembly2.cif.gz_D the yfib-yfir complex 0.9094 106 208
ID Description Score Start End Superfamily
5u1hB00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.9317 102 211 3.30.1330.60
3td4B00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.9308 102 211 3.30.1330.60
5n2cC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.8997 105 209 3.30.1330.60
4zhwA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.8897 105 207 3.30.1330.60
5y61D00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.8668 106 209 3.30.1330.60
ID Description Score Start End GO Terms
AF-A0A2S5CIK3-F1-model_v4 OmpA family protein 0.9434 101 211 GO:0009279
AF-A0A1X7AMJ3-F1-model_v4 Outer membrane porin F 0.9434 104 209 GO:0005509
GO:0009279
AF-A0A3B0TBT2-F1-model_v4 Tol-Pal system peptidoglycan-associated lipoprotein PAL 0.9428 105 209 GO:0009279
GO:0051301
AF-A0A4R4KJ73-F1-model_v4 OmpA family protein 0.9427 104 211 GO:0016020
AF-A0A2S5Q9W2-F1-model_v4 deleted 0.9417 102 211

Map