F245263

General Info

Members Datasets Scaffolds Average Seq Length
165 121 330 119

Family's Representative Sequence

Representative Sequence 3300005290|Ga0065712_10067987|Ga0065712_100679875
Length 135
Sequence MFEHKTQPLAPRHKFFIRLARHFCWTLLIVGFSLAMGSCGYHFIAGLDWIDSFHNASMILTGMGPLNPMPSVPAKLFSSFYALYSGVAFLTMVATLLAPVAHRFMHRLHLEELEDDDADEGKADRAMNESEEIRP

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
62 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
63 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
64 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
65 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
66 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
67 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
68 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
69 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
70 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
71 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
72 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
73 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
74 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
75 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
76 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
77 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
78 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
79 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
80 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
81 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
85 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
86 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
87 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
88 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
89 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
90 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
91 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
92 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
93 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
94 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
95 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
96 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
97 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
98 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
99 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
100 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
101 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
102 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
103 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
104 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
105 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
106 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
107 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
108 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
109 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
110 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
111 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
112 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
113 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
114 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
115 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
116 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
117 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
118 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
119 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
120 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
121 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.21
Nodule 0
Rhizoplane 1.21
Rhizosphere 96.97
Stem 0
Stem Tuber 0
Unclassified 29.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10067987 3300005290 Bacteria 17955
2 MRS1b_contig_108253 2162886011 Bacteria 3128
3 Ga0070683_100039156 3300005329 Bacteria 4350
4 Ga0070690_100754423 3300005330 Unclassified 751
5 Ga0070690_101455291 3300005330 Bacteria 552
6 Ga0068869_100010787 3300005334 Bacteria 5970
7 Ga0068869_101097993 3300005334 Bacteria 696
8 Ga0070689_100127236 3300005340 Bacteria 2040
9 Ga0070671_100176929 3300005355 Unclassified 1806
10 Ga0070688_100222020 3300005365 Bacteria 1332
11 Ga0070694_100054169 3300005444 Unclassified 2717
12 Ga0068867_101486892 3300005459 Unclassified 630
13 Ga0070685_10879856 3300005466 Unclassified 665
14 Ga0070706_100449465 3300005467 Unclassified 1199
15 Ga0070706_100738810 3300005467 Bacteria 912
16 Ga0070707_101588058 3300005468 Unclassified 621
17 Ga0070698_100005206 3300005471 Bacteria 14227
18 Ga0070698_100047162 3300005471 Bacteria 4404
19 Ga0070699_100183182 3300005518 Unclassified 1859
20 Ga0070695_100251768 3300005545 Unclassified 1286
21 Ga0070704_100032877 3300005549 Unclassified 3503
22 Ga0070664_100403864 3300005564 Bacteria 1250
23 Ga0068857_100153808 3300005577 Bacteria 2085
24 Ga0068852_101949895 3300005616 Bacteria 609
25 Ga0068859_102984643 3300005617 Bacteria 517
26 Ga0068864_100660185 3300005618 Unclassified 1019
27 Ga0068861_100002933 3300005719 Bacteria 11255
28 Ga0068863_100779250 3300005841 Bacteria 953
29 Ga0068860_100275750 3300005843 Bacteria 1642
30 Ga0068862_100449038 3300005844 Unclassified 1215
31 Ga0070717_10402242 3300006028 Unclassified 1230
32 Ga0075428_100003288 3300006844 Bacteria 17671
33 Ga0075428_100009881 3300006844 Bacteria 10604
34 Ga0075428_101290222 3300006844 Bacteria 768
35 Ga0075430_100023592 3300006846 Bacteria 5239
36 Ga0075431_100003710 3300006847 Bacteria 14839
37 Ga0075431_101387815 3300006847 Bacteria 662
38 Ga0075433_10008722 3300006852 Bacteria 8090
39 Ga0075433_10409692 3300006852 Unclassified 1196
40 Ga0075433_11208115 3300006852 Unclassified 656
41 Ga0075434_100000718 3300006871 Bacteria 25916
42 Ga0075434_101538352 3300006871 Bacteria 674
43 Ga0075436_100067090 3300006914 Bacteria 2480
44 Ga0075436_100500130 3300006914 Unclassified 889
45 Ga0105240_10486842 3300009093 Bacteria 1374
46 Ga0111539_10031477 3300009094 Bacteria 6443
47 Ga0111539_10132008 3300009094 Bacteria 2924
48 Ga0111539_11583642 3300009094 Bacteria 760
49 Ga0111539_11849750 3300009094 Bacteria 700
50 Ga0114129_10190207 3300009147 Bacteria 2788
51 Ga0105243_10177635 3300009148 Bacteria 1849
52 Ga0105248_10102353 3300009177 Bacteria 3228
53 Ga0105248_10140568 3300009177 Unclassified 2724
54 Ga0105237_10138356 3300009545 Unclassified 2429
55 Ga0105249_10039777 3300009553 Bacteria 4269
56 Ga0105239_10138488 3300010375 Unclassified 2711
57 Ga0157371_10792789 3300013102 Bacteria 714
58 Ga0157370_10471986 3300013104 Bacteria 1153
59 Ga0157378_11435849 3300013297 Bacteria 733
60 Ga0157372_10076039 3300013307 Bacteria 3790
61 Ga0157372_10112089 3300013307 Bacteria 3125
62 Ga0157372_12955185 3300013307 Bacteria 544
63 Ga0157375_11226294 3300013308 Unclassified 880
64 Ga0157375_11713881 3300013308 Unclassified 744
65 Ga0163163_11292145 3300014325 Bacteria 792
66 Ga0163163_11697519 3300014325 Unclassified 692
67 Ga0157380_10034619 3300014326 Unclassified 3896
68 Ga0157380_10257108 3300014326 Bacteria 1584
69 Ga0157380_11040985 3300014326 Unclassified 854
70 Ga0157376_10930306 3300014969 Unclassified 889
71 Ga0207653_10038523 3300025885 Bacteria 1562
72 Ga0207684_10307424 3300025910 Bacteria 1367
73 Ga0207649_10102519 3300025920 Bacteria 1897
74 Ga0207709_10441133 3300025935 Bacteria 1004
75 Ga0207661_10071005 3300025944 Bacteria 2844
76 Ga0207679_12048237 3300025945 Bacteria 521
77 Ga0207708_10054892 3300026075 Bacteria 3037
78 Ga0207641_10658055 3300026088 Bacteria 1029
79 Ga0207674_10169942 3300026116 Unclassified 2134
80 Ga0207675_100001971 3300026118 Bacteria 20453
81 Ga0268264_10882573 3300028381 Bacteria 897
82 Ga0265334_10004622 3300028573 Bacteria 6084
83 Ga0265338_10058052 3300028800 Bacteria 3419
84 Ga0265320_10093447 3300031240 Bacteria 1391
85 Ga0307408_100012158 3300031548 Bacteria 5699
86 Ga0307408_101114935 3300031548 Bacteria 732
87 Ga0316576_10045203 3300031727 Unclassified 3183
88 Ga0316578_10002283 3300031728 Bacteria 8322
89 Ga0307405_10134836 3300031731 Bacteria 1712
90 Ga0307413_10085657 3300031824 Bacteria 2035
91 Ga0307406_10274248 3300031901 Unclassified 1283
92 Ga0307407_10161448 3300031903 Unclassified 1467
93 Ga0307409_101140933 3300031995 Unclassified 801
94 Ga0307416_100080528 3300032002 Bacteria 2749
95 Ga0307414_10426959 3300032004 Bacteria 1157
96 Ga0307411_10034206 3300032005 Bacteria 3160
97 Ga0307415_100101868 3300032126 Bacteria 2108
98 Ga0373953_0100156 3300035117 Unclassified 1219
99 Ga0373954_0095533 3300035118 Bacteria 1431
100 Ga0373933_0497521 3300035724 Bacteria 799
101 Ga0373937_0177319 3300036401 Bacteria 2001
102 Ga0373937_1083484 3300036401 Unclassified 750
103 Ga0316584_0025064 3300036712 Unclassified 4372
104 Ga0316584_0070917 3300036712 Bacteria 2611
105 Ga0395899_0049224 3300037312 Bacteria 3134
106 Ga0395900_0139216 3300037418 Bacteria 2486
107 Ga0395905_0596517 3300037471 Bacteria 1006
108 Ga0395905_0633633 3300037471 Unclassified 971
109 Ga0451847_0688269 3300041503 Unclassified 520
110 Ga0439449_0083241 3300042007 Bacteria 1180
111 Ga0439457_029958 3300042014 Bacteria 1206
112 Ga0439462_0045355 3300042015 Bacteria 1177
113 Ga0451577_0005542 3300042876 Bacteria 12865
114 Ga0451577_0023484 3300042876 Bacteria 5624
115 Ga0451577_0039625 3300042876 Bacteria 4234
116 Ga0466972_0508790 3300044658 Unclassified 567
117 Ga0453684_0060443 3300044712 Bacteria 4873
118 Ga0453684_0062699 3300044712 Bacteria 4760
119 Ga0453684_0074739 3300044712 Bacteria 4264
120 Ga0453684_0148017 3300044712 Bacteria 2794
121 Ga0453684_0181108 3300044712 Bacteria 2473
122 Ga0453684_0554739 3300044712 Bacteria 1265
123 Ga0453684_1616202 3300044712 Unclassified 665
124 Ga0466959_0084493 3300045049 Bacteria 2285
125 Ga0451576_0100291 3300045051 Bacteria 3011
126 Ga0451576_0346300 3300045051 Bacteria 1556
127 Ga0451576_0906766 3300045051 Bacteria 925
128 Ga0451576_1000614 3300045051 Bacteria 876
129 Ga0451576_1623135 3300045051 Bacteria 670
130 Ga0451576_1895652 3300045051 Bacteria 615
131 Ga0495592_0061443 3300046454 Bacteria 2761
132 Ga0495629_0892301 3300046459 Unclassified 583
133 Ga0495664_0162087 3300046477 Bacteria 1357
134 Ga0495608_0004455 3300046511 Bacteria 10020
135 Ga0495628_0512216 3300046516 Bacteria 865
136 Ga0495628_0537080 3300046516 Unclassified 841
137 Ga0495640_0344081 3300046533 Bacteria 921
138 Ga0495586_0579217 3300046535 Unclassified 648
139 Ga0495645_0174976 3300046543 Bacteria 1475
140 Ga0495667_0004660 3300046559 Bacteria 9275
141 Ga0495634_0068506 3300046642 Bacteria 2344
142 Ga0495613_0083640 3300046689 Unclassified 2318
143 Ga0495680_0688067 3300047322 Unclassified 676
144 Ga0495684_0909250 3300047471 Bacteria 566
145 Ga0496100_1241431 3300048903 Unclassified 588
146 Ga0496104_1196764 3300048907 Unclassified 663
147 Ga0501299_054947 3300049522 Bacteria 831
148 Ga0501235_191991 3300049669 Unclassified 549
149 Ga0501261_024906 3300049690 Bacteria 878
150 Ga0501266_038106 3300049763 Bacteria 707
151 Ga0501283_080508 3300049779 Unclassified 612
152 nmdc:mga05p37_227236_c1 3300050507 Bacteria 2250
153 nmdc:mga05p37_3377_c1 3300050507 Bacteria 18631
154 nmdc:mga09592_36507_c1 3300050508 Bacteria 4117
155 nmdc:mga0qj67_316269_c1 3300050509 Bacteria 1264
156 nmdc:mga06r32_1217325_c1 3300050510 Bacteria 699
157 nmdc:mga06r32_22209_c1 3300050510 Bacteria 5863
158 nmdc:mga06r32_3999_c1 3300050510 Bacteria 13211
159 nmdc:mga08y16_107726_c1 3300050511 Unclassified 2901
160 nmdc:mga08y16_112944_c1 3300050511 Bacteria 2828
161 nmdc:mga08y16_1644500_c1 3300050511 Bacteria 599
162 nmdc:mga0n895_2611_c1 3300050512 Bacteria 14173
163 nmdc:mga0a205_16743_c1 3300050515 Bacteria 6865
164 Ga0500650_0391051 3300053098 Bacteria 603
165 Ga0500573_0523363 3300053140 Unclassified 531
166 Ga0065712_10067987
167 MRS1b_contig_108253
168 Ga0070683_100039156
169 Ga0070690_100754423
170 Ga0070690_101455291
171 Ga0068869_100010787
172 Ga0068869_101097993
173 Ga0070689_100127236
174 Ga0070671_100176929
175 Ga0070688_100222020
176 Ga0070694_100054169
177 Ga0068867_101486892
178 Ga0070685_10879856
179 Ga0070706_100449465
180 Ga0070706_100738810
181 Ga0070707_101588058
182 Ga0070698_100005206
183 Ga0070698_100047162
184 Ga0070699_100183182
185 Ga0070695_100251768
186 Ga0070704_100032877
187 Ga0070664_100403864
188 Ga0068857_100153808
189 Ga0068852_101949895
190 Ga0068859_102984643
191 Ga0068864_100660185
192 Ga0068861_100002933
193 Ga0068863_100779250
194 Ga0068860_100275750
195 Ga0068862_100449038
196 Ga0070717_10402242
197 Ga0075428_100003288
198 Ga0075428_100009881
199 Ga0075428_101290222
200 Ga0075430_100023592
201 Ga0075431_100003710
202 Ga0075431_101387815
203 Ga0075433_10008722
204 Ga0075433_10409692
205 Ga0075433_11208115
206 Ga0075434_100000718
207 Ga0075434_101538352
208 Ga0075436_100067090
209 Ga0075436_100500130
210 Ga0105240_10486842
211 Ga0111539_10031477
212 Ga0111539_10132008
213 Ga0111539_11583642
214 Ga0111539_11849750
215 Ga0114129_10190207
216 Ga0105243_10177635
217 Ga0105248_10102353
218 Ga0105248_10140568
219 Ga0105237_10138356
220 Ga0105249_10039777
221 Ga0105239_10138488
222 Ga0157371_10792789
223 Ga0157370_10471986
224 Ga0157378_11435849
225 Ga0157372_10076039
226 Ga0157372_10112089
227 Ga0157372_12955185
228 Ga0157375_11226294
229 Ga0157375_11713881
230 Ga0163163_11292145
231 Ga0163163_11697519
232 Ga0157380_10034619
233 Ga0157380_10257108
234 Ga0157380_11040985
235 Ga0157376_10930306
236 Ga0207653_10038523
237 Ga0207684_10307424
238 Ga0207649_10102519
239 Ga0207709_10441133
240 Ga0207661_10071005
241 Ga0207679_12048237
242 Ga0207708_10054892
243 Ga0207641_10658055
244 Ga0207674_10169942
245 Ga0207675_100001971
246 Ga0268264_10882573
247 Ga0265334_10004622
248 Ga0265338_10058052
249 Ga0265320_10093447
250 Ga0307408_100012158
251 Ga0307408_101114935
252 Ga0316576_10045203
253 Ga0316578_10002283
254 Ga0307405_10134836
255 Ga0307413_10085657
256 Ga0307406_10274248
257 Ga0307407_10161448
258 Ga0307409_101140933
259 Ga0307416_100080528
260 Ga0307414_10426959
261 Ga0307411_10034206
262 Ga0307415_100101868
263 Ga0373953_0100156
264 Ga0373954_0095533
265 Ga0373933_0497521
266 Ga0373937_0177319
267 Ga0373937_1083484
268 Ga0316584_0025064
269 Ga0316584_0070917
270 Ga0395899_0049224
271 Ga0395900_0139216
272 Ga0395905_0596517
273 Ga0395905_0633633
274 Ga0451847_0688269
275 Ga0439449_0083241
276 Ga0439457_029958
277 Ga0439462_0045355
278 Ga0451577_0005542
279 Ga0451577_0023484
280 Ga0451577_0039625
281 Ga0466972_0508790
282 Ga0453684_0060443
283 Ga0453684_0062699
284 Ga0453684_0074739
285 Ga0453684_0148017
286 Ga0453684_0181108
287 Ga0453684_0554739
288 Ga0453684_1616202
289 Ga0466959_0084493
290 Ga0451576_0100291
291 Ga0451576_0346300
292 Ga0451576_0906766
293 Ga0451576_1000614
294 Ga0451576_1623135
295 Ga0451576_1895652
296 Ga0495592_0061443
297 Ga0495629_0892301
298 Ga0495664_0162087
299 Ga0495608_0004455
300 Ga0495628_0512216
301 Ga0495628_0537080
302 Ga0495640_0344081
303 Ga0495586_0579217
304 Ga0495645_0174976
305 Ga0495667_0004660
306 Ga0495634_0068506
307 Ga0495613_0083640
308 Ga0495680_0688067
309 Ga0495684_0909250
310 Ga0496100_1241431
311 Ga0496104_1196764
312 Ga0501299_054947
313 Ga0501235_191991
314 Ga0501261_024906
315 Ga0501266_038106
316 Ga0501283_080508
317 nmdc:mga05p37_227236_c1
318 nmdc:mga05p37_3377_c1
319 nmdc:mga09592_36507_c1
320 nmdc:mga0qj67_316269_c1
321 nmdc:mga06r32_1217325_c1
322 nmdc:mga06r32_22209_c1
323 nmdc:mga06r32_3999_c1
324 nmdc:mga08y16_107726_c1
325 nmdc:mga08y16_112944_c1
326 nmdc:mga08y16_1644500_c1
327 nmdc:mga0n895_2611_c1
328 nmdc:mga0a205_16743_c1
329 Ga0500650_0391051
330 Ga0500573_0523363

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rbz-assembly1.cif.gz_B-2 mthk channel, ca2+-bound 0.8825 33 85
3rbz-assembly1.cif.gz_C-2 mthk channel, ca2+-bound 0.8817 33 91
3rbz-assembly1.cif.gz_D-2 mthk channel, ca2+-bound 0.8762 28 89
7e87-assembly1.cif.gz_A cryoem structure of the human kv4.2-dpp6s complex, transmembrane and intracellular region 0.8727 18 126
7f0j-assembly1.cif.gz_B cryoem structure of human kv4.2 0.8664 18 126
ID Description Score Start End Superfamily
af_Q4E159_45_255_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8966 19 98 1.10.287.70
3rbzA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8798 28 89 1.10.287.70
af_Q55CU6_305_415_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8787 19 102 1.10.287.70
af_Q8ILA3_486_701_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8734 19 98 1.10.287.70
af_K7L5I6_274_336_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8584 29 87 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A7T9CN93-F1-model_v4 deleted 0.9867 19 111
AF-A0A370ECM6-F1-model_v4 Ion channel 0.9829 20 108 GO:0016020
AF-A0A7W8HHS6-F1-model_v4 Two pore domain potassium channel family protein 0.9822 18 107 GO:0016020
AF-A0A0E4BQ61-F1-model_v4 Potassium channel domain-containing protein 0.9794 20 109 GO:0016020
AF-A0A534DLJ2-F1-model_v4 deleted 0.9781 14 112

Map