F244936

General Info

Members Datasets Scaffolds Average Seq Length
164 134 140 217

Family's Representative Sequence

Representative Sequence 3300053156|Ga0500622_0001134|Ga0500622_0001134_16350_17105
Length 251
Sequence MPGELFTAELLNKPSLDFLTKQRRLVISYFCYMQLKIIITGATGMAGEGVLLECLQNQAVSEVLMVNRRHLDLAHPKLKELIVPDFLKIENHSDVLKGYDACFFCAGISSVGMSEEKYIVITYDTTMHVAKTLAAIQPGMVFNYITGSHTDSSEQGKSMWARVKGKTENDLMKLPFRGQYNFRPGGMRTVKGQKNAKMIYTVIVSIIQLFSPKSIISLHELGQAMINASLQGYPKQVLEIRDIKALAKVTP

Samples

Sample ID Description Type Environment
1 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
2 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
3 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
4 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
5 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
6 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
7 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
8 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
9 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
10 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
11 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
12 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
13 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
14 2738541284 Pedobacter sp. YR016 Isolate Unclassified
15 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
16 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
17 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
18 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
19 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
20 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
21 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
22 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
23 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
24 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
25 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
26 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
27 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
28 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
29 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
30 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
31 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
32 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
33 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
34 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
63 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
64 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
66 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
67 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
92 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
99 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
100 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
101 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
102 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
103 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
104 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
105 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
106 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
107 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
108 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
109 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
110 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
113 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
114 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
115 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
116 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
117 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
118 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
119 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
120 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
121 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
122 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
123 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
126 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
127 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
128 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
129 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
130 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
133 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
134 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.37
Metatranscriptomes 0
Isolates 14.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.93
Nodule 0
Rhizoplane 1.22
Rhizosphere 75.61
Stem 0
Stem Tuber 0
Unclassified 15.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000017 3300002773 Bacteria 109718
2 JGI25150J39212_1000001 3300002774 Bacteria 1318726
3 JGI25151J46595_10000001 3300003187 Bacteria 887211
4 JGI25153J46596_10000053 3300003215 Bacteria 138301
5 rootH2_10109671 3300003320 Unclassified 1131
6 rootH1_10093822 3300003323 Bacteria 5585
7 rootH1_10292955 3300003323 Bacteria 2177
8 Ga0055534_1012785 3300003784 Bacteria 1643
9 Ga0065714_10002345 3300005288 Bacteria 23040
10 Ga0065714_10236685 3300005288 Bacteria 804
11 Ga0070658_10217263 3300005327 Bacteria 1616
12 Ga0070676_10112761 3300005328 Bacteria 1695
13 Ga0070682_100000339 3300005337 Bacteria 32181
14 Ga0068868_100012431 3300005338 Bacteria 6223
15 Ga0070660_100662602 3300005339 Bacteria 874
16 Ga0070661_100585207 3300005344 Bacteria 901
17 Ga0070668_100065133 3300005347 Bacteria 2826
18 Ga0070669_100039177 3300005353 Bacteria 3443
19 Ga0070673_100605612 3300005364 Bacteria 999
20 Ga0070659_100052534 3300005366 Bacteria 3206
21 Ga0070681_10289784 3300005458 Unclassified 1547
22 Ga0068867_100250867 3300005459 Bacteria 1439
23 Ga0068867_100392490 3300005459 Bacteria 1168
24 Ga0070685_10153788 3300005466 Bacteria 1460
25 Ga0070684_100024673 3300005535 Bacteria 5045
26 Ga0068853_100015375 3300005539 Bacteria 6288
27 Ga0068864_100118321 3300005618 Bacteria 2366
28 Ga0068860_100739538 3300005843 Bacteria 995
29 Ga0111539_10302459 3300009094 Bacteria 1861
30 Ga0105242_10343146 3300009176 Unclassified 1377
31 Ga0105242_10459907 3300009176 Bacteria 1201
32 Ga0157373_10067006 3300013100 Unclassified 2539
33 Ga0157371_10198048 3300013102 Bacteria 1439
34 Ga0157370_10001379 3300013104 Bacteria 30046
35 Ga0157370_10587922 3300013104 Unclassified 1020
36 Ga0157370_10693832 3300013104 Bacteria 929
37 Ga0157378_10036092 3300013297 Bacteria 4375
38 Ga0157378_10812445 3300013297 Bacteria 961
39 Ga0157372_10069070 3300013307 Bacteria 3974
40 Ga0157372_10313633 3300013307 Bacteria 1826
41 Ga0157372_10345450 3300013307 Unclassified 1734
42 Ga0163163_10208855 3300014325 Bacteria 2001
43 Ga0182008_10000009 3300014497 Bacteria 331416
44 Ga0157379_10282925 3300014968 Bacteria 1509
45 Ga0182006_1000003 3300015261 Bacteria 826681
46 Ga0163161_10282921 3300017792 Bacteria 1301
47 Ga0207425_1000002 3300025245 Bacteria 1362590
48 Ga0209129_1000002 3300025258 Bacteria 1359086
49 Ga0209675_1000053 3300025291 Bacteria 194511
50 Ga0209025_1000004 3300025294 Bacteria 1361782
51 Ga0209758_1000006 3300025297 Bacteria 1359562
52 Ga0207655_1000013 3300025728 Bacteria 637510
53 Ga0207643_10253612 3300025908 Bacteria 1084
54 Ga0207662_10506788 3300025918 Bacteria 832
55 Ga0207681_10265533 3300025923 Bacteria 1345
56 Ga0207659_10052320 3300025926 Bacteria 2909
57 Ga0207690_10008291 3300025932 Bacteria 6163
58 Ga0207686_10350431 3300025934 Bacteria 1111
59 Ga0207709_10014775 3300025935 Bacteria 4317
60 Ga0207670_10146388 3300025936 Bacteria 1747
61 Ga0207691_10128721 3300025940 Bacteria 2238
62 Ga0207661_10312932 3300025944 Unclassified 1410
63 Ga0207679_10027839 3300025945 Bacteria 3914
64 Ga0207640_10101405 3300025981 Bacteria 2020
65 Ga0207640_10576631 3300025981 Bacteria 949
66 Ga0207677_10014526 3300026023 Bacteria 4601
67 Ga0207703_10471730 3300026035 Bacteria 1175
68 Ga0207639_10018447 3300026041 Bacteria 4958
69 Ga0207639_10232603 3300026041 Bacteria 1598
70 Ga0207708_10132168 3300026075 Bacteria 1952
71 Ga0207648_10156532 3300026089 Bacteria 2011
72 Ga0207676_10949401 3300026095 Bacteria 845
73 Ga0207675_100004950 3300026118 Bacteria 12839
74 Ga0207698_10298354 3300026142 Bacteria 1499
75 Ga0268265_10468636 3300028380 Bacteria 1180
76 Ga0307515_10000001 3300028794 Bacteria 4259510
77 Ga0265338_10020633 3300028800 Bacteria 6919
78 Ga0265327_10000026 3300031251 Bacteria 379288
79 Ga0265327_10122494 3300031251 Bacteria 1231
80 Ga0307508_10001513 3300031616 Bacteria 25952
81 Ga0307413_10186523 3300031824 Bacteria 1485
82 Ga0307409_100154778 3300031995 Bacteria 1996
83 Ga0307416_100000001 3300032002 Bacteria 515017
84 Ga0307416_100000031 3300032002 Bacteria 159059
85 Ga0307416_100003789 3300032002 Bacteria 8977
86 Ga0307414_10024470 3300032004 Bacteria 3851
87 Ga0307414_10128882 3300032004 Bacteria 1960
88 Ga0307415_100003946 3300032126 Bacteria 7625
89 Ga0439445_0000491 3300042004 Bacteria 8008
90 Ga0439445_0047586 3300042004 Bacteria 1152
91 Ga0439449_0020640 3300042007 Bacteria 2468
92 Ga0439462_0030547 3300042015 Unclassified 1425
93 Ga0451577_0153063 3300042876 Bacteria 2075
94 Ga0453684_0000143 3300044712 Bacteria 315998
95 Ga0453684_0116941 3300044712 Bacteria 3227
96 Ga0453684_0181507 3300044712 Bacteria 2470
97 Ga0451576_0001894 3300045051 Bacteria 33576
98 Ga0451576_0063238 3300045051 Bacteria 3858
99 Ga0451576_0299563 3300045051 Bacteria 1681
100 Ga0495596_0000834 3300046500 Bacteria 18651
101 Ga0495606_0003433 3300046507 Bacteria 16813
102 Ga0495610_0000006 3300046512 Bacteria 856822
103 Ga0495648_0059796 3300046524 Bacteria 2271
104 Ga0495663_0002489 3300046525 Bacteria 5543
105 Ga0495661_0008244 3300046665 Bacteria 7218
106 Ga0495672_0124673 3300047320 Bacteria 1364
107 Ga0496102_0128868 3300048905 Bacteria 2366
108 Ga0496114_0002298 3300048917 Bacteria 14565
109 Ga0496116_0000006 3300048919 Bacteria 811937
110 Ga0496117_0000027 3300048920 Bacteria 412234
111 Ga0496118_0000163 3300048921 Bacteria 119492
112 Ga0496119_0000006 3300048922 Bacteria 505999
113 Ga0496121_0308520 3300048924 Bacteria 1071
114 Ga0496122_0000073 3300048925 Bacteria 222403
115 Ga0496122_0000163 3300048925 Bacteria 158337
116 Ga0496122_0000258 3300048925 Bacteria 119618
117 Ga0496122_0001248 3300048925 Bacteria 42723
118 Ga0496122_0018134 3300048925 Bacteria 6521
119 Ga0496123_0000853 3300048926 Bacteria 48656
120 Ga0496123_0009786 3300048926 Bacteria 8568
121 Ga0496124_0001110 3300048927 Bacteria 42348
122 Ga0496125_0002152 3300048928 Bacteria 26391
123 Ga0496125_0005212 3300048928 Bacteria 14587
124 Ga0496126_0003573 3300048929 Bacteria 19506
125 Ga0496126_0204577 3300048929 Bacteria 1665
126 Ga0501033_0238499 3300049570 Bacteria 1290
127 Ga0501034_0077808 3300049571 Bacteria 3322
128 Ga0501217_031251 3300049661 Bacteria 1311
129 Ga0501217_032588 3300049661 Bacteria 1290
130 Ga0501249_030177 3300049679 Bacteria 1207
131 Ga0501253_016507 3300049683 Bacteria 1230
132 Ga0501257_024039 3300049686 Bacteria 1446
133 Ga0501221_058327 3300049704 Unclassified 887
134 Ga0501221_068406 3300049704 Bacteria 834
135 Ga0501245_002470 3300049708 Bacteria 2471
136 Ga0501044_0016411 3300049823 Bacteria 7951
137 Ga0501044_0423757 3300049823 Bacteria 1241
138 Ga0500651_0000016 3300053093 Bacteria 161074
139 Ga0500622_0001134 3300053156 Bacteria 22229
140 Ga0500638_212676 3300053162 Bacteria 809

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049823 Ga0501044_0423757 Ga0501044_0423757_624_1220 195
2 3300005288 Ga0065714_10236685 Ga0065714_102366851 204
3 3300025935 Ga0207709_10014775 Ga0207709_100147751 204
4 3300031616 Ga0307508_10001513 Ga0307508_1000151326 204
5 3300017792 Ga0163161_10282921 Ga0163161_102829212 205
6 3300025940 Ga0207691_10128721 Ga0207691_101287212 205
7 3300032004 Ga0307414_10128882 Ga0307414_101288821 205
8 3300042876 Ga0451577_0153063 Ga0451577_0153063_655_1287 205
9 3300044712 Ga0453684_0000143 Ga0453684_0000143_7270_7902 205
10 3300045051 Ga0451576_0063238 Ga0451576_0063238_453_1085 205
11 3300049661 Ga0501217_032588 Ga0501217_032588_651_1268 205
12 3300049661 Ga0501217_031251 Ga0501217_031251_569_1228 206
13 3300049679 Ga0501249_030177 Ga0501249_030177_439_1098 206
14 3300049683 Ga0501253_016507 Ga0501253_016507_269_928 206
15 3300049708 Ga0501245_002470 Ga0501245_002470_1745_2404 206
16 3300005288 Ga0065714_10002345 Ga0065714_1000234518 208
17 3300028800 Ga0265338_10020633 Ga0265338_100206338 209
18 iso_pu_bacteria 2588254255 2590601399 210
19 3300053162 Ga0500638_212676 Ga0500638_212676_96_740 211
20 iso_pu_bacteria 2919191525 2919193426 211
21 iso_pu_bacteria 2511231000 2511231860 213
22 iso_pu_bacteria 2582581278 2585142971 213
23 iso_pu_bacteria 2582581281 2585156299 213
24 iso_pu_bacteria 2582581282 2585160508 213
25 iso_pu_bacteria 2585428045 2587680198 213
26 iso_pu_bacteria 2585428060 2587745979 213
27 iso_pu_bacteria 2585428182 2588210168 213
28 iso_pu_bacteria 2585428183 2588214619 213
29 iso_pu_bacteria 2585428184 2588217840 213
30 iso_pu_bacteria 2585428185 2588222950 213
31 iso_pu_bacteria 2588253712 2588444261 213
32 iso_pu_bacteria 2588254257 2590614027 213
33 iso_pu_bacteria 2751185877 2753674542 213
34 iso_pu_bacteria 2765235839 2765574069 213
35 iso_pu_bacteria 2816332188 2816874288 213
36 iso_pu_bacteria 2842083920 2842086053 213
37 iso_pu_bacteria 2889290771 2889295412 213
38 iso_pu_bacteria 2905999023 2905999899 213
39 iso_pu_bacteria 2919186247 2919186829 213
40 iso_pu_bacteria 2939664404 2939665902 213
41 iso_pu_bacteria 2946019816 2946022524 213
42 3300003784 Ga0055534_1012785 Ga0055534_10127852 214
43 3300005337 Ga0070682_100000339 Ga0070682_10000033914 214
44 3300005353 Ga0070669_100039177 Ga0070669_1000391774 214
45 3300009094 Ga0111539_10302459 Ga0111539_103024592 214
46 3300013104 Ga0157370_10001379 Ga0157370_100013793 214
47 3300015261 Ga0182006_1000003 Ga0182006_1000003188 214
48 3300025291 Ga0209675_1000053 Ga0209675_1000053189 214
49 3300025728 Ga0207655_1000013 Ga0207655_1000013378 214
50 3300025908 Ga0207643_10253612 Ga0207643_102536121 214
51 3300025918 Ga0207662_10506788 Ga0207662_105067881 214
52 3300025923 Ga0207681_10265533 Ga0207681_102655333 214
53 3300025936 Ga0207670_10146388 Ga0207670_101463882 214
54 3300026075 Ga0207708_10132168 Ga0207708_101321682 214
55 3300026118 Ga0207675_100004950 Ga0207675_10000495011 214
56 3300028380 Ga0268265_10468636 Ga0268265_104686361 214
57 3300032002 Ga0307416_100000031 Ga0307416_1000000314 214
58 3300032004 Ga0307414_10024470 Ga0307414_100244703 214
59 3300042004 Ga0439445_0000491 Ga0439445_0000491_7180_7833 214
60 3300046500 Ga0495596_0000834 Ga0495596_0000834_8449_9102 214
61 3300046507 Ga0495606_0003433 Ga0495606_0003433_7143_7802 214
62 3300046512 Ga0495610_0000006 Ga0495610_0000006_685395_686048 214
63 3300046524 Ga0495648_0059796 Ga0495648_0059796_1561_2229 214
64 3300046525 Ga0495663_0002489 Ga0495663_0002489_3657_4316 214
65 3300046665 Ga0495661_0008244 Ga0495661_0008244_3885_4553 214
66 3300048905 Ga0496102_0128868 Ga0496102_0128868_1099_1752 214
67 3300048919 Ga0496116_0000006 Ga0496116_0000006_220958_221611 214
68 3300048920 Ga0496117_0000027 Ga0496117_0000027_133571_134224 214
69 3300048921 Ga0496118_0000163 Ga0496118_0000163_73586_74239 214
70 3300048922 Ga0496119_0000006 Ga0496119_0000006_455870_456523 214
71 3300048924 Ga0496121_0308520 Ga0496121_0308520_223_876 214
72 3300048925 Ga0496122_0000073 Ga0496122_0000073_171422_172075 214
73 3300048925 Ga0496122_0000163 Ga0496122_0000163_108989_109642 214
74 3300048925 Ga0496122_0000258 Ga0496122_0000258_80344_80997 214
75 3300048925 Ga0496122_0001248 Ga0496122_0001248_20707_21360 214
76 3300048925 Ga0496122_0018134 Ga0496122_0018134_3580_4233 214
77 3300048926 Ga0496123_0000853 Ga0496123_0000853_4896_5549 214
78 3300048926 Ga0496123_0009786 Ga0496123_0009786_5397_6050 214
79 3300048927 Ga0496124_0001110 Ga0496124_0001110_23984_24637 214
80 3300048928 Ga0496125_0002152 Ga0496125_0002152_12390_13043 214
81 3300048928 Ga0496125_0005212 Ga0496125_0005212_70_723 214
82 3300048929 Ga0496126_0003573 Ga0496126_0003573_2121_2774 214
83 3300048929 Ga0496126_0204577 Ga0496126_0204577_667_1320 214
84 3300049570 Ga0501033_0238499 Ga0501033_0238499_305_958 214
85 3300049571 Ga0501034_0077808 Ga0501034_0077808_84_737 214
86 3300049823 Ga0501044_0016411 Ga0501044_0016411_1699_2352 214
87 3300053093 Ga0500651_0000016 Ga0500651_0000016_103227_103895 214
88 iso_pu_bacteria 2738541284 2738762797 214
89 3300003323 rootH1_10292955 rootH1_102929552 215
90 3300005328 Ga0070676_10112761 Ga0070676_101127612 215
91 3300005338 Ga0068868_100012431 Ga0068868_1000124315 215
92 3300005347 Ga0070668_100065133 Ga0070668_1000651332 215
93 3300005364 Ga0070673_100605612 Ga0070673_1006056122 215
94 3300005366 Ga0070659_100052534 Ga0070659_1000525342 215
95 3300005459 Ga0068867_100250867 Ga0068867_1002508672 215
96 3300005459 Ga0068867_100392490 Ga0068867_1003924901 215
97 3300005466 Ga0070685_10153788 Ga0070685_101537881 215
98 3300005535 Ga0070684_100024673 Ga0070684_1000246731 215
99 3300005539 Ga0068853_100015375 Ga0068853_1000153754 215
100 3300005618 Ga0068864_100118321 Ga0068864_1001183213 215
101 3300005843 Ga0068860_100739538 Ga0068860_1007395381 215
102 3300009176 Ga0105242_10343146 Ga0105242_103431462 215
103 3300009176 Ga0105242_10459907 Ga0105242_104599072 215
104 3300013297 Ga0157378_10036092 Ga0157378_100360924 215
105 3300013297 Ga0157378_10812445 Ga0157378_108124452 215
106 3300013307 Ga0157372_10313633 Ga0157372_103136332 215
107 3300014325 Ga0163163_10208855 Ga0163163_102088553 215
108 3300014968 Ga0157379_10282925 Ga0157379_102829252 215
109 3300025926 Ga0207659_10052320 Ga0207659_100523202 215
110 3300025932 Ga0207690_10008291 Ga0207690_100082918 215
111 3300025934 Ga0207686_10350431 Ga0207686_103504312 215
112 3300025944 Ga0207661_10312932 Ga0207661_103129322 215
113 3300025945 Ga0207679_10027839 Ga0207679_100278391 215
114 3300025981 Ga0207640_10101405 Ga0207640_101014051 215
115 3300025981 Ga0207640_10576631 Ga0207640_105766311 215
116 3300026023 Ga0207677_10014526 Ga0207677_100145264 215
117 3300026035 Ga0207703_10471730 Ga0207703_104717301 215
118 3300026041 Ga0207639_10018447 Ga0207639_100184473 215
119 3300026041 Ga0207639_10232603 Ga0207639_102326032 215
120 3300026089 Ga0207648_10156532 Ga0207648_101565322 215
121 3300026095 Ga0207676_10949401 Ga0207676_109494011 215
122 3300031251 Ga0265327_10000026 Ga0265327_10000026159 215
123 3300031251 Ga0265327_10122494 Ga0265327_101224941 215
124 3300031824 Ga0307413_10186523 Ga0307413_101865233 215
125 3300031995 Ga0307409_100154778 Ga0307409_1001547782 215
126 3300032002 Ga0307416_100000001 Ga0307416_100000001178 215
127 3300032002 Ga0307416_100003789 Ga0307416_1000037892 215
128 3300032126 Ga0307415_100003946 Ga0307415_1000039469 215
129 3300042004 Ga0439445_0047586 Ga0439445_0047586_121_777 215
130 3300042007 Ga0439449_0020640 Ga0439449_0020640_32_697 215
131 3300042015 Ga0439462_0030547 Ga0439462_0030547_15_677 215
132 3300044712 Ga0453684_0116941 Ga0453684_0116941_1162_1821 215
133 3300044712 Ga0453684_0181507 Ga0453684_0181507_25_711 215
134 3300045051 Ga0451576_0001894 Ga0451576_0001894_2213_2881 215
135 3300045051 Ga0451576_0299563 Ga0451576_0299563_126_785 215
136 3300047320 Ga0495672_0124673 Ga0495672_0124673_559_1206 215
137 3300048917 Ga0496114_0002298 Ga0496114_0002298_5523_6200 215
138 3300049686 Ga0501257_024039 Ga0501257_024039_582_1244 215
139 3300049704 Ga0501221_058327 Ga0501221_058327_213_869 215
140 3300049704 Ga0501221_068406 Ga0501221_068406_43_699 215
141 3300002773 JGI25152J39213_1000017 JGI25152J39213_100001782 216
142 3300002774 JGI25150J39212_1000001 JGI25150J39212_1000001756 216
143 3300003187 JGI25151J46595_10000001 JGI25151J46595_1000000149 216
144 3300003215 JGI25153J46596_10000053 JGI25153J46596_1000005363 216
145 3300003320 rootH2_10109671 rootH2_101096711 216
146 3300003323 rootH1_10093822 rootH1_100938223 216
147 3300005327 Ga0070658_10217263 Ga0070658_102172632 216
148 3300005339 Ga0070660_100662602 Ga0070660_1006626021 216
149 3300005344 Ga0070661_100585207 Ga0070661_1005852071 216
150 3300005458 Ga0070681_10289784 Ga0070681_102897841 216
151 3300013100 Ga0157373_10067006 Ga0157373_100670065 216
152 3300013102 Ga0157371_10198048 Ga0157371_101980482 216
153 3300013104 Ga0157370_10587922 Ga0157370_105879222 216
154 3300013104 Ga0157370_10693832 Ga0157370_106938322 216
155 3300013307 Ga0157372_10069070 Ga0157372_100690705 216
156 3300013307 Ga0157372_10345450 Ga0157372_103454501 216
157 3300014497 Ga0182008_10000009 Ga0182008_10000009161 216
158 3300025245 Ga0207425_1000002 Ga0207425_1000002422 216
159 3300025258 Ga0209129_1000002 Ga0209129_1000002422 216
160 3300025294 Ga0209025_1000004 Ga0209025_1000004768 216
161 3300025297 Ga0209758_1000006 Ga0209758_1000006768 216
162 3300026142 Ga0207698_10298354 Ga0207698_102983542 216
163 3300028794 Ga0307515_10000001 Ga0307515_10000001950 216
164 3300053156 Ga0500622_0001134 Ga0500622_0001134_16350_17105 216

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

37

159

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fmu-assembly1.cif.gz_A crystal structure of a tat-interacting protein homologue (htatip2, aw111545, cc3, tip30) from mus musculus at 2.30 a resolution 0.8453 2 214
2bka-assembly1.cif.gz_A-2 cc3(tip30)crystal structure 0.8036 2 214
2bka-assembly1.cif.gz_A-2 cc3(tip30)crystal structure 0.7898 2 214
8jqk-assembly1.cif.gz_B crystal structure of a carbonyl reductase sscr mutant from sporobolomyces salmonicolor 0.7856 2 205
4ivm-assembly1.cif.gz_B structure of human protoporphyrinogen ix oxidase(r59g) 0.7795 2 35
ID Description Score Start End Superfamily
af_Q54WF5_27_272_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9347 1 215 3.40.50.720
af_Q54WF5_27_272_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9264 1 215 3.40.50.720
2fmuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8453 2 214 3.40.50.720
af_Q5AP65_1_228_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8243 1 214 3.40.50.720
af_Q5AP65_1_228_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.814 1 214 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1W1W0L8-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9827 1 152
AF-A0A327SI48-F1-model_v4 Uncharacterized protein YbjT (DUF2867 family) 0.9824 1 213
AF-S7VE36-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9814 1 132
AF-A0A1G8EHA9-F1-model_v4 NAD dependent epimerase/dehydratase family protein 0.9807 1 213
AF-A0A7Z9INY0-F1-model_v4 Epimerase 0.98 2 117

Feature Viewer

pLDDT pTM Quality
94.18 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map