F244334

General Info

Members Datasets Scaffolds Average Seq Length
164 115 328 142

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0734945|Ga0395899_0734945_46_513
Length 155
Sequence MRGGAPPTKVETRLMSKQKVLILCTGNSARSQMAEGLLRSMTADRLSVASAGVAPSQVRAEAIEAMREIGIDISEQRSKSVDEFTGEEFDYVITVCDNANEQCPVFPGKTKRIHWSFEDPAAVTGEWDQRLEAFRKVRDQIEERLFEFAELGNVE

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
45 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
64 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
65 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
66 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
67 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
68 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
69 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
70 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
71 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
72 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
73 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
74 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
75 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
76 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
77 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
78 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
79 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
80 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
81 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
82 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
83 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
84 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
85 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
86 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
87 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
89 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
90 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
91 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
92 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
93 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
94 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
95 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
96 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
97 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
98 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
99 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
100 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
101 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
102 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
103 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
104 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
105 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
106 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
107 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
108 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
109 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
110 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
111 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
112 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
113 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
114 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
115 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.39
Metatranscriptomes 0.61
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.44
Rhizosphere 96.95
Stem 0
Stem Tuber 0
Unclassified 14.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0734945 3300037312 Bacteria 616
2 rootL2_10022422 3300003322 Bacteria 1580
3 Ga0065704_10138712 3300005289 Unclassified 1541
4 Ga0065715_10178042 3300005293 Bacteria 1464
5 Ga0065715_10621915 3300005293 Unclassified 695
6 Ga0065707_10104440 3300005295 Bacteria 2695
7 Ga0070690_100716063 3300005330 Bacteria 770
8 Ga0068869_100755046 3300005334 Unclassified 833
9 Ga0068868_100118299 3300005338 Bacteria 2159
10 Ga0070689_100951476 3300005340 Bacteria 762
11 Ga0070675_100056377 3300005354 Bacteria 3238
12 Ga0070674_100667070 3300005356 Unclassified 885
13 Ga0070673_100020555 3300005364 Bacteria 4763
14 Ga0070688_100399778 3300005365 Bacteria 1017
15 Ga0070694_100138258 3300005444 Bacteria 1767
16 Ga0070708_100243549 3300005445 Bacteria 1688
17 Ga0070708_100465067 3300005445 Bacteria 1193
18 Ga0068867_100088264 3300005459 Bacteria 2349
19 Ga0070706_100010490 3300005467 Bacteria 8600
20 Ga0070706_100017866 3300005467 Bacteria 6544
21 Ga0070706_101491125 3300005467 Unclassified 618
22 Ga0070707_100008123 3300005468 Bacteria 9734
23 Ga0070707_100659222 3300005468 Bacteria 1009
24 Ga0070707_100913645 3300005468 Bacteria 842
25 Ga0070698_100006132 3300005471 Bacteria 13097
26 Ga0070698_100013901 3300005471 Bacteria 8514
27 Ga0070698_100224660 3300005471 Bacteria 1811
28 Ga0070699_100089082 3300005518 Bacteria 2696
29 Ga0070699_100357388 3300005518 Bacteria 1316
30 Ga0070697_100021663 3300005536 Bacteria 5094
31 Ga0070697_100427066 3300005536 Bacteria 1152
32 Ga0070697_100428601 3300005536 Bacteria 1150
33 Ga0068853_101859155 3300005539 Bacteria 584
34 Ga0070695_100084715 3300005545 Bacteria 2103
35 Ga0070695_100393141 3300005545 Bacteria 1049
36 Ga0070696_101225962 3300005546 Bacteria 635
37 Ga0070693_100923303 3300005547 Unclassified 656
38 Ga0068864_100062180 3300005618 Bacteria 3235
39 Ga0068864_100156399 3300005618 Bacteria 2069
40 Ga0068861_100074226 3300005719 Bacteria 2644
41 Ga0068860_100760250 3300005843 Unclassified 981
42 Ga0081540_1033334 3300005983 Bacteria 2799
43 Ga0081539_10006405 3300005985 Bacteria 11318
44 Ga0097621_100008563 3300006237 Bacteria 7373
45 Ga0068871_101026551 3300006358 Bacteria 769
46 Ga0075430_100001148 3300006846 Bacteria 21122
47 Ga0075430_100934606 3300006846 Unclassified 714
48 Ga0075431_100002833 3300006847 Bacteria 16775
49 Ga0075433_10122088 3300006852 Bacteria 2314
50 Ga0075434_100050449 3300006871 Bacteria 4133
51 Ga0075434_100431004 3300006871 Bacteria 1340
52 Ga0075429_100118561 3300006880 Bacteria 2313
53 Ga0097620_102414857 3300006931 Bacteria 579
54 Ga0075435_100081473 3300007076 Bacteria 2659
55 Ga0075435_100373820 3300007076 Bacteria 1224
56 Ga0114129_10029577 3300009147 Bacteria 7757
57 Ga0114129_10229218 3300009147 Bacteria 2503
58 Ga0114129_11129417 3300009147 Bacteria 980
59 Ga0114129_12129686 3300009147 Bacteria 676
60 Ga0114129_13487912 3300009147 Bacteria 503
61 Ga0105248_10651517 3300009177 Bacteria 1188
62 Ga0105248_11907770 3300009177 Unclassified 674
63 Ga0157378_10170425 3300013297 Unclassified 2041
64 Ga0157378_11672383 3300013297 Unclassified 683
65 Ga0157376_10269254 3300014969 Bacteria 1599
66 Ga0163161_10012790 3300017792 Bacteria 5829
67 Ga0224712_10411761 3300022467 Unclassified 645
68 Ga0207684_10008536 3300025910 Bacteria 9112
69 Ga0207684_10069860 3300025910 Bacteria 2985
70 Ga0207646_10002071 3300025922 Bacteria 24057
71 Ga0207646_10583070 3300025922 Bacteria 1004
72 Ga0207659_10178574 3300025926 Bacteria 1680
73 Ga0207700_11240552 3300025928 Unclassified 665
74 Ga0207706_10259904 3300025933 Bacteria 1516
75 Ga0207709_10137652 3300025935 Bacteria 1674
76 Ga0207709_10390394 3300025935 Unclassified 1061
77 Ga0207670_10025952 3300025936 Bacteria 3686
78 Ga0207670_10188446 3300025936 Bacteria 1559
79 Ga0207670_10509358 3300025936 Bacteria 978
80 Ga0207691_10004531 3300025940 Bacteria 13442
81 Ga0207711_10591574 3300025941 Unclassified 1035
82 Ga0207689_10023169 3300025942 Bacteria 5213
83 Ga0207679_10133713 3300025945 Bacteria 1994
84 Ga0207712_10111463 3300025961 Unclassified 2053
85 Ga0207640_10101407 3300025981 Bacteria 2020
86 Ga0207677_10141600 3300026023 Bacteria 1842
87 Ga0207675_100030235 3300026118 Bacteria 5045
88 Ga0207675_100059373 3300026118 Unclassified 3569
89 Ga0268265_10145824 3300028380 Bacteria 1989
90 Ga0268264_10205091 3300028381 Bacteria 1806
91 Ga0265319_1000556 3300028563 Bacteria 25323
92 Ga0265338_10077027 3300028800 Bacteria 2821
93 Ga0265314_10456482 3300031711 Bacteria 680
94 Ga0307413_11431214 3300031824 Bacteria 609
95 Ga0307410_11017432 3300031852 Bacteria 715
96 Ga0307411_10702682 3300032005 Bacteria 881
97 Ga0307415_100069359 3300032126 Bacteria 2472
98 Ga0316580_10070792 3300032139 Unclassified 1068
99 Ga0373953_0142502 3300035117 Bacteria 1025
100 Ga0373955_1057441 3300035172 Unclassified 500
101 Ga0373931_0837324 3300035691 Bacteria 615
102 Ga0373937_2029904 3300036401 Unclassified 521
103 Ga0316584_0018002 3300036712 Bacteria 5091
104 Ga0451795_0906374 3300041456 Bacteria 700
105 Ga0451577_0095007 3300042876 Bacteria 2662
106 Ga0451577_0243970 3300042876 Bacteria 1626
107 Ga0451577_0352130 3300042876 Unclassified 1336
108 Ga0451577_0462991 3300042876 Bacteria 1151
109 Ga0451577_0919694 3300042876 Unclassified 787
110 Ga0453683_0000331 3300044673 Bacteria 58273
111 Ga0453683_0019454 3300044673 Bacteria 4348
112 Ga0453683_0105146 3300044673 Bacteria 1773
113 Ga0453683_0105891 3300044673 Bacteria 1767
114 Ga0453683_0258130 3300044673 Bacteria 1111
115 Ga0453683_0324654 3300044673 Bacteria 986
116 Ga0453684_0000023 3300044712 Bacteria 857153
117 Ga0453684_0000269 3300044712 Bacteria 223826
118 Ga0453684_0008814 3300044712 Bacteria 17894
119 Ga0453684_0012844 3300044712 Bacteria 13724
120 Ga0453684_0023672 3300044712 Bacteria 9025
121 Ga0453684_0114774 3300044712 Bacteria 3265
122 Ga0453684_0125868 3300044712 Bacteria 3084
123 Ga0453684_0147437 3300044712 Bacteria 2801
124 Ga0453684_0166641 3300044712 Bacteria 2600
125 Ga0453684_0202508 3300044712 Unclassified 2313
126 Ga0453684_0218109 3300044712 Bacteria 2212
127 Ga0453684_0434091 3300044712 Bacteria 1465
128 Ga0453684_0478042 3300044712 Bacteria 1382
129 Ga0466960_0211323 3300044901 Bacteria 1064
130 Ga0451576_0003147 3300045051 Bacteria 23118
131 Ga0495664_0162285 3300046477 Bacteria 1356
132 Ga0495586_0068203 3300046535 Bacteria 1940
133 Ga0496108_0000156 3300048911 Bacteria 64810
134 Ga0496110_0054575 3300048913 Bacteria 3515
135 Ga0496111_0707790 3300048914 Bacteria 732
136 Ga0501042_1084982 3300049578 Bacteria 584
137 Ga0501199_051124 3300049650 Bacteria 558
138 Ga0501202_002506 3300049652 Bacteria 3087
139 Ga0501214_028844 3300049659 Bacteria 750
140 Ga0501217_003118 3300049661 Bacteria 3323
141 Ga0501223_002389 3300049663 Bacteria 4194
142 Ga0501227_000218 3300049665 Bacteria 11548
143 Ga0501230_027138 3300049667 Bacteria 1044
144 Ga0501233_062304 3300049668 Bacteria 928
145 Ga0501236_017015 3300049670 Bacteria 1035
146 Ga0501242_039608 3300049674 Bacteria 663
147 Ga0501243_009230 3300049675 Bacteria 1531
148 Ga0501249_059005 3300049679 Bacteria 887
149 Ga0501252_052107 3300049682 Bacteria 620
150 Ga0501257_015611 3300049686 Bacteria 1755
151 Ga0501260_013293 3300049689 Bacteria 848
152 Ga0501219_007330 3300049703 Bacteria 797
153 Ga0501221_134180 3300049704 Bacteria 643
154 Ga0501225_0003400 3300049705 Bacteria 4830
155 Ga0501229_000718 3300049706 Bacteria 3736
156 Ga0501234_009227 3300049707 Bacteria 1537
157 Ga0501267_030097 3300049764 Bacteria 636
158 Ga0501268_034001 3300049765 Bacteria 935
159 Ga0501270_038535 3300049767 Bacteria 823
160 Ga0501273_018750 3300049770 Bacteria 923
161 Ga0501283_107522 3300049779 Bacteria 548
162 Ga0501204_017442 3300049850 Bacteria 909
163 Ga0501212_001704 3300049851 Bacteria 2530
164 nmdc:mga0a205_435562_c1 3300050515 Bacteria 1172
165 Ga0395899_0734945
166 rootL2_10022422
167 Ga0065704_10138712
168 Ga0065715_10178042
169 Ga0065715_10621915
170 Ga0065707_10104440
171 Ga0070690_100716063
172 Ga0068869_100755046
173 Ga0068868_100118299
174 Ga0070689_100951476
175 Ga0070675_100056377
176 Ga0070674_100667070
177 Ga0070673_100020555
178 Ga0070688_100399778
179 Ga0070694_100138258
180 Ga0070708_100243549
181 Ga0070708_100465067
182 Ga0068867_100088264
183 Ga0070706_100010490
184 Ga0070706_100017866
185 Ga0070706_101491125
186 Ga0070707_100008123
187 Ga0070707_100659222
188 Ga0070707_100913645
189 Ga0070698_100006132
190 Ga0070698_100013901
191 Ga0070698_100224660
192 Ga0070699_100089082
193 Ga0070699_100357388
194 Ga0070697_100021663
195 Ga0070697_100427066
196 Ga0070697_100428601
197 Ga0068853_101859155
198 Ga0070695_100084715
199 Ga0070695_100393141
200 Ga0070696_101225962
201 Ga0070693_100923303
202 Ga0068864_100062180
203 Ga0068864_100156399
204 Ga0068861_100074226
205 Ga0068860_100760250
206 Ga0081540_1033334
207 Ga0081539_10006405
208 Ga0097621_100008563
209 Ga0068871_101026551
210 Ga0075430_100001148
211 Ga0075430_100934606
212 Ga0075431_100002833
213 Ga0075433_10122088
214 Ga0075434_100050449
215 Ga0075434_100431004
216 Ga0075429_100118561
217 Ga0097620_102414857
218 Ga0075435_100081473
219 Ga0075435_100373820
220 Ga0114129_10029577
221 Ga0114129_10229218
222 Ga0114129_11129417
223 Ga0114129_12129686
224 Ga0114129_13487912
225 Ga0105248_10651517
226 Ga0105248_11907770
227 Ga0157378_10170425
228 Ga0157378_11672383
229 Ga0157376_10269254
230 Ga0163161_10012790
231 Ga0224712_10411761
232 Ga0207684_10008536
233 Ga0207684_10069860
234 Ga0207646_10002071
235 Ga0207646_10583070
236 Ga0207659_10178574
237 Ga0207700_11240552
238 Ga0207706_10259904
239 Ga0207709_10137652
240 Ga0207709_10390394
241 Ga0207670_10025952
242 Ga0207670_10188446
243 Ga0207670_10509358
244 Ga0207691_10004531
245 Ga0207711_10591574
246 Ga0207689_10023169
247 Ga0207679_10133713
248 Ga0207712_10111463
249 Ga0207640_10101407
250 Ga0207677_10141600
251 Ga0207675_100030235
252 Ga0207675_100059373
253 Ga0268265_10145824
254 Ga0268264_10205091
255 Ga0265319_1000556
256 Ga0265338_10077027
257 Ga0265314_10456482
258 Ga0307413_11431214
259 Ga0307410_11017432
260 Ga0307411_10702682
261 Ga0307415_100069359
262 Ga0316580_10070792
263 Ga0373953_0142502
264 Ga0373955_1057441
265 Ga0373931_0837324
266 Ga0373937_2029904
267 Ga0316584_0018002
268 Ga0451795_0906374
269 Ga0451577_0095007
270 Ga0451577_0243970
271 Ga0451577_0352130
272 Ga0451577_0462991
273 Ga0451577_0919694
274 Ga0453683_0000331
275 Ga0453683_0019454
276 Ga0453683_0105146
277 Ga0453683_0105891
278 Ga0453683_0258130
279 Ga0453683_0324654
280 Ga0453684_0000023
281 Ga0453684_0000269
282 Ga0453684_0008814
283 Ga0453684_0012844
284 Ga0453684_0023672
285 Ga0453684_0114774
286 Ga0453684_0125868
287 Ga0453684_0147437
288 Ga0453684_0166641
289 Ga0453684_0202508
290 Ga0453684_0218109
291 Ga0453684_0434091
292 Ga0453684_0478042
293 Ga0466960_0211323
294 Ga0451576_0003147
295 Ga0495664_0162285
296 Ga0495586_0068203
297 Ga0496108_0000156
298 Ga0496110_0054575
299 Ga0496111_0707790
300 Ga0501042_1084982
301 Ga0501199_051124
302 Ga0501202_002506
303 Ga0501214_028844
304 Ga0501217_003118
305 Ga0501223_002389
306 Ga0501227_000218
307 Ga0501230_027138
308 Ga0501233_062304
309 Ga0501236_017015
310 Ga0501242_039608
311 Ga0501243_009230
312 Ga0501249_059005
313 Ga0501252_052107
314 Ga0501257_015611
315 Ga0501260_013293
316 Ga0501219_007330
317 Ga0501221_134180
318 Ga0501225_0003400
319 Ga0501229_000718
320 Ga0501234_009227
321 Ga0501267_030097
322 Ga0501268_034001
323 Ga0501270_038535
324 Ga0501273_018750
325 Ga0501283_107522
326 Ga0501204_017442
327 Ga0501212_001704
328 nmdc:mga0a205_435562_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01451

LMWPc

Low molecular weight phosphotyrosine protein phosphatase

20

149

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p6m-assembly1.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus 0.9699 3 136
8p6m-assembly1.cif.gz_A arsenate reductase (arsc2) from deinococcus indicus 0.965 3 135
8p6m-assembly1.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus 0.9482 3 136
1rxi-assembly1.cif.gz_A pi258 arsenate reductase (arsc) triple mutant c10s/c15a/c82s 0.9398 2 136
2fxi-assembly1.cif.gz_A arsenate reductase (arsc from pi258) c10s/c15a double mutant with sulfate in its active site 0.9377 2 136
ID Description Score Start End Superfamily
1jl3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9351 2 133 3.40.50.2300
af_A0A0R4IIK5_129_224_1.10.246.10 Mainly Alpha;Orthogonal Bundle;Serum Albumin; Chain A, Domain 1; 0.9057 105 130 1.10.246.10
1jl3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9022 2 133 3.40.50.2300
af_I6X4W4_364_495_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8937 2 135 3.40.50.2300
2myuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8841 3 135 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7S8IH47-F1-model_v4 Arsenate reductase ArsC 1.002 1 136 GO:0046685
AF-A0A3B9KGC3-F1-model_v4 Protein-tyrosine-phosphatase 0.9997 1 92 GO:0046685
AF-A0A2E0UYF8-F1-model_v4 Protein-tyrosine-phosphatase 0.9965 1 135 GO:0046685
AF-A0A8B5XGH4-F1-model_v4 Arsenate reductase ArsC 0.995 2 135 GO:0046685
AF-A0A2V9M334-F1-model_v4 Protein-tyrosine-phosphatase 0.9946 21 135 GO:0046685

Map