F244218

General Info

Members Datasets Scaffolds Average Seq Length
164 79 328 233

Family's Representative Sequence

Representative Sequence 3300031727|Ga0316576_10113948|Ga0316576_101139482
Length 243
Sequence MGPNSTNETISMPSVSYQKRRGQIEAYFDRTAAEAWKRLTSDAPVSGIRATVRAGRDEMRKTLLGYLPADLNGKRLLDAGCGTGMLSLEAARRGATVYAVDLSPTLIANARERVPEELSGHIDYAVGDMLAPEQGEFDHIVAMDSLIHYELEDALNVIEGFASRARASVLFTFAPRTPALALMHAVGQFFPRSDRSPAIVPVAVDRLRGAIGAAPELSEWRVGRTQRISRGFYTSQAMELTRS

Samples

Sample ID Description Type Environment
1 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
4 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
7 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
8 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
9 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
10 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
11 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
12 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
13 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
14 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
15 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
16 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
17 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
18 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
25 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
26 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
27 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
28 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
29 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
30 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
31 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
32 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
33 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
34 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
35 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
36 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
37 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
38 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
39 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
40 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
41 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
42 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
43 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
44 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
45 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
46 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
47 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
48 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
49 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
50 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
51 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
52 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
53 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
54 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
55 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
56 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
57 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
58 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
59 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
60 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
61 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
62 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
63 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
64 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
65 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
66 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
67 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
68 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
69 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
70 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
71 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
72 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
73 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
74 2643221585 Pelomonas sp. Root662 Isolate Unclassified
75 2643221656 Pelomonas sp. Root405 Isolate Unclassified
76 2643221660 Methylibium sp. Root1272 Isolate Unclassified
77 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
78 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
79 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.63
Metatranscriptomes 6.71
Isolates 3.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.22
Nodule 0.61
Rhizoplane 3.05
Rhizosphere 85.98
Stem 0
Stem Tuber 0
Unclassified 1.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316576_10113948 3300031727 Bacteria 2028
2 rootH1_10246377 3300003323 Bacteria 1724
3 JGI26128J50194_1002030 3300003347 Bacteria 1313
4 Ga0070669_100190261 3300005353 Bacteria 1610
5 Ga0070667_100607151 3300005367 Bacteria 1008
6 Ga0070665_100377833 3300005548 Bacteria 1424
7 Ga0068863_100118162 3300005841 Bacteria 2527
8 Ga0068858_100253735 3300005842 Bacteria 1671
9 Ga0075365_10005379 3300006038 Bacteria 6897
10 Ga0070712_100147186 3300006175 Bacteria 1804
11 Ga0105243_10976493 3300009148 Bacteria 848
12 Ga0105248_10177285 3300009177 Bacteria 2402
13 Ga0105239_10306362 3300010375 Bacteria 1789
14 Ga0157378_10018606 3300013297 Bacteria 6108
15 Ga0163162_11511141 3300013306 Bacteria 765
16 Ga0213876_10045582 3300021384 Bacteria 2318
17 Ga0213875_10183593 3300021388 Bacteria 983
18 Ga0207649_10339264 3300025920 Bacteria 1109
19 Ga0207694_10373716 3300025924 Bacteria 1182
20 Ga0207644_10788049 3300025931 Bacteria 795
21 Ga0207703_10090452 3300026035 Bacteria 2572
22 Ga0207639_10053999 3300026041 Bacteria 3069
23 Ga0207702_10454130 3300026078 Bacteria 1244
24 Ga0209968_1005091 3300027526 Bacteria 1971
25 Ga0209966_1000013 3300027695 Bacteria 83121
26 Ga0265337_1003714 3300028556 Bacteria 6525
27 Ga0265326_10012690 3300028558 Bacteria 2471
28 Ga0265319_1004858 3300028563 Bacteria 6577
29 Ga0265334_10001855 3300028573 Bacteria 10057
30 Ga0265334_10085879 3300028573 Unclassified 1154
31 Ga0265323_10001594 3300028653 Bacteria 10940
32 Ga0265322_10003363 3300028654 Bacteria 4843
33 Ga0265336_10001303 3300028666 Bacteria 11675
34 Ga0265338_10000081 3300028800 Bacteria 176402
35 Ga0265324_10006214 3300029957 Bacteria 5026
36 Ga0265332_10043671 3300031238 Bacteria 1935
37 Ga0265328_10000102 3300031239 Bacteria 41869
38 Ga0265328_10002882 3300031239 Bacteria 7674
39 Ga0265325_10039459 3300031241 Bacteria 2487
40 Ga0265329_10058331 3300031242 Bacteria 1223
41 Ga0265340_10091810 3300031247 Bacteria 1418
42 Ga0265331_10001308 3300031250 Bacteria 18466
43 Ga0265327_10000613 3300031251 Bacteria 58852
44 Ga0265327_10021226 3300031251 Bacteria 3924
45 Ga0265327_10150351 3300031251 Bacteria 1081
46 Ga0265316_10010270 3300031344 Bacteria 8542
47 Ga0265316_10099461 3300031344 Bacteria 2212
48 Ga0316575_10000918 3300031665 Bacteria 9060
49 Ga0316575_10018043 3300031665 Bacteria 2687
50 Ga0316575_10182558 3300031665 Bacteria 871
51 Ga0316579_10000187 3300031691 Bacteria 18075
52 Ga0316579_10004244 3300031691 Bacteria 5675
53 Ga0316579_10007356 3300031691 Bacteria 4546
54 Ga0316579_10051846 3300031691 Bacteria 1920
55 Ga0265342_10117044 3300031712 Bacteria 1504
56 Ga0316576_10001077 3300031727 Bacteria 14188
57 Ga0316576_10001976 3300031727 Bacteria 11457
58 Ga0316576_10007224 3300031727 Bacteria 6972
59 Ga0316576_10024539 3300031727 Bacteria 4210
60 Ga0316576_10027573 3300031727 Bacteria 3995
61 Ga0316576_10156051 3300031727 Bacteria 1720
62 Ga0316576_10198285 3300031727 Bacteria 1512
63 Ga0316576_10213847 3300031727 Bacteria 1451
64 Ga0316576_10311925 3300031727 Bacteria 1174
65 Ga0316578_10000893 3300031728 Bacteria 11258
66 Ga0316578_10001626 3300031728 Bacteria 9307
67 Ga0316578_10002963 3300031728 Bacteria 7636
68 Ga0316578_10024977 3300031728 Bacteria 3355
69 Ga0316578_10032334 3300031728 Bacteria 2988
70 Ga0316578_10041116 3300031728 Bacteria 2676
71 Ga0316578_10048361 3300031728 Bacteria 2483
72 Ga0316578_10054462 3300031728 Bacteria 2346
73 Ga0316578_10089552 3300031728 Bacteria 1836
74 Ga0316578_10190790 3300031728 Bacteria 1234
75 Ga0316578_10221960 3300031728 Bacteria 1136
76 Ga0316578_10290562 3300031728 Bacteria 978
77 Ga0316577_10000604 3300031733 Bacteria 14818
78 Ga0316577_10000984 3300031733 Bacteria 12723
79 Ga0316577_10003065 3300031733 Bacteria 8387
80 Ga0316577_10004906 3300031733 Bacteria 6969
81 Ga0316577_10014347 3300031733 Bacteria 4348
82 Ga0316577_10040167 3300031733 Bacteria 2617
83 Ga0316577_10056017 3300031733 Bacteria 2200
84 Ga0316577_10179922 3300031733 Bacteria 1194
85 Ga0316583_10007981 3300032133 Bacteria 3815
86 Ga0316583_10048668 3300032133 Bacteria 1492
87 Ga0316585_10000076 3300032137 Bacteria 16627
88 Ga0316585_10005593 3300032137 Bacteria 3553
89 Ga0316585_10032785 3300032137 Bacteria 1637
90 Ga0316585_10043842 3300032137 Bacteria 1428
91 Ga0316580_10000517 3300032139 Bacteria 8904
92 Ga0316580_10001555 3300032139 Bacteria 6051
93 Ga0316580_10001759 3300032139 Bacteria 5788
94 Ga0316580_10007972 3300032139 Bacteria 3165
95 Ga0316593_10001023 3300032168 Bacteria 5797
96 Ga0316593_10019676 3300032168 Bacteria 2089
97 Ga0316592_1002850 3300033524 Bacteria 3040
98 Ga0316592_1005216 3300033524 Bacteria 2456
99 Ga0316588_1000004 3300033528 Bacteria 16160
100 Ga0316588_1000087 3300033528 Bacteria 8414
101 Ga0316588_1000344 3300033528 Bacteria 5964
102 Ga0316588_1002102 3300033528 Bacteria 3417
103 Ga0316588_1006619 3300033528 Bacteria 2323
104 Ga0316588_1026752 3300033528 Bacteria 1337
105 Ga0316596_1001115 3300033541 Bacteria 5242
106 Ga0316574_0000045 3300035398 Bacteria 30677
107 Ga0316574_0000719 3300035398 Bacteria 14168
108 Ga0316574_0001681 3300035398 Bacteria 10678
109 Ga0316574_0026028 3300035398 Bacteria 3517
110 Ga0316574_0033643 3300035398 Bacteria 3120
111 Ga0316574_0044264 3300035398 Bacteria 2753
112 Ga0316574_0051739 3300035398 Bacteria 2560
113 Ga0316574_0154972 3300035398 Bacteria 1476
114 Ga0316582_0000025 3300036647 Bacteria 35921
115 Ga0316582_0002623 3300036647 Bacteria 8518
116 Ga0316582_0005432 3300036647 Bacteria 6564
117 Ga0316582_0055766 3300036647 Bacteria 2519
118 Ga0316582_0137483 3300036647 Bacteria 1645
119 Ga0316582_0358918 3300036647 Bacteria 1003
120 Ga0316584_0002621 3300036712 Bacteria 11464
121 Ga0316584_0005336 3300036712 Bacteria 8614
122 Ga0316584_0005357 3300036712 Bacteria 8604
123 Ga0316584_0011263 3300036712 Bacteria 6278
124 Ga0316584_0014580 3300036712 Bacteria 5600
125 Ga0316584_0025138 3300036712 Bacteria 4365
126 Ga0316584_0026836 3300036712 Bacteria 4236
127 Ga0316584_0030051 3300036712 Bacteria 4012
128 Ga0316584_0050562 3300036712 Bacteria 3108
129 Ga0316584_0069465 3300036712 Bacteria 2641
130 Ga0316584_0091873 3300036712 Bacteria 2272
131 Ga0316584_0092269 3300036712 Bacteria 2267
132 Ga0316584_0128005 3300036712 Bacteria 1896
133 Ga0316584_0248606 3300036712 Bacteria 1299
134 Ga0316584_0299251 3300036712 Bacteria 1165
135 Ga0436364_0984938 3300037853 Bacteria 1237
136 Ga0400483_076476 3300039062 Bacteria 10411
137 Ga0400483_089437 3300039062 Bacteria 2944
138 Ga0400483_212777 3300039062 Bacteria 18396
139 Ga0400483_258117 3300039062 Bacteria 1683
140 Ga0436365_1865259 3300039437 Bacteria 3076
141 Ga0451577_0003807 3300042876 Bacteria 16426
142 Ga0451577_0010718 3300042876 Bacteria 8727
143 Ga0451577_0017482 3300042876 Bacteria 6624
144 Ga0451577_0018795 3300042876 Bacteria 6358
145 Ga0453684_0037442 3300044712 Bacteria 6658
146 Ga0453684_0093146 3300044712 Bacteria 3712
147 Ga0451576_0001261 3300045051 Bacteria 44384
148 Ga0495668_0393806 3300046616 Bacteria 761
149 Ga0495686_0172226 3300047472 Bacteria 1258
150 Ga0496107_0434645 3300048910 Unclassified 976
151 Ga0496109_0549956 3300048912 Bacteria 1089
152 Ga0496109_0562038 3300048912 Bacteria 1076
153 Ga0496112_0121317 3300048915 Bacteria 2584
154 Ga0496115_0322129 3300048918 Bacteria 1264
155 Ga0496123_0049796 3300048926 Bacteria 2805
156 Ga0496124_0191068 3300048927 Bacteria 1567
157 Ga0501044_0020042 3300049823 Bacteria 7141
158 nmdc:mga0yw44_2439_c1 3300050492 Bacteria 7927
159 2643937307 2643221585 Bacteria 5812563
160 2644318472 2643221656 Bacteria 5809961
161 2644338222 2643221660 Bacteria 4208257
162 2842336639 2842333319 Bacteria 8899485
163 2894777048 2894772417 Bacteria 5305674
164 8045864965 8045864390 Bacteria 5043873
165 Ga0316576_10113948
166 rootH1_10246377
167 JGI26128J50194_1002030
168 Ga0070669_100190261
169 Ga0070667_100607151
170 Ga0070665_100377833
171 Ga0068863_100118162
172 Ga0068858_100253735
173 Ga0075365_10005379
174 Ga0070712_100147186
175 Ga0105243_10976493
176 Ga0105248_10177285
177 Ga0105239_10306362
178 Ga0157378_10018606
179 Ga0163162_11511141
180 Ga0213876_10045582
181 Ga0213875_10183593
182 Ga0207649_10339264
183 Ga0207694_10373716
184 Ga0207644_10788049
185 Ga0207703_10090452
186 Ga0207639_10053999
187 Ga0207702_10454130
188 Ga0209968_1005091
189 Ga0209966_1000013
190 Ga0265337_1003714
191 Ga0265326_10012690
192 Ga0265319_1004858
193 Ga0265334_10001855
194 Ga0265334_10085879
195 Ga0265323_10001594
196 Ga0265322_10003363
197 Ga0265336_10001303
198 Ga0265338_10000081
199 Ga0265324_10006214
200 Ga0265332_10043671
201 Ga0265328_10000102
202 Ga0265328_10002882
203 Ga0265325_10039459
204 Ga0265329_10058331
205 Ga0265340_10091810
206 Ga0265331_10001308
207 Ga0265327_10000613
208 Ga0265327_10021226
209 Ga0265327_10150351
210 Ga0265316_10010270
211 Ga0265316_10099461
212 Ga0316575_10000918
213 Ga0316575_10018043
214 Ga0316575_10182558
215 Ga0316579_10000187
216 Ga0316579_10004244
217 Ga0316579_10007356
218 Ga0316579_10051846
219 Ga0265342_10117044
220 Ga0316576_10001077
221 Ga0316576_10001976
222 Ga0316576_10007224
223 Ga0316576_10024539
224 Ga0316576_10027573
225 Ga0316576_10156051
226 Ga0316576_10198285
227 Ga0316576_10213847
228 Ga0316576_10311925
229 Ga0316578_10000893
230 Ga0316578_10001626
231 Ga0316578_10002963
232 Ga0316578_10024977
233 Ga0316578_10032334
234 Ga0316578_10041116
235 Ga0316578_10048361
236 Ga0316578_10054462
237 Ga0316578_10089552
238 Ga0316578_10190790
239 Ga0316578_10221960
240 Ga0316578_10290562
241 Ga0316577_10000604
242 Ga0316577_10000984
243 Ga0316577_10003065
244 Ga0316577_10004906
245 Ga0316577_10014347
246 Ga0316577_10040167
247 Ga0316577_10056017
248 Ga0316577_10179922
249 Ga0316583_10007981
250 Ga0316583_10048668
251 Ga0316585_10000076
252 Ga0316585_10005593
253 Ga0316585_10032785
254 Ga0316585_10043842
255 Ga0316580_10000517
256 Ga0316580_10001555
257 Ga0316580_10001759
258 Ga0316580_10007972
259 Ga0316593_10001023
260 Ga0316593_10019676
261 Ga0316592_1002850
262 Ga0316592_1005216
263 Ga0316588_1000004
264 Ga0316588_1000087
265 Ga0316588_1000344
266 Ga0316588_1002102
267 Ga0316588_1006619
268 Ga0316588_1026752
269 Ga0316596_1001115
270 Ga0316574_0000045
271 Ga0316574_0000719
272 Ga0316574_0001681
273 Ga0316574_0026028
274 Ga0316574_0033643
275 Ga0316574_0044264
276 Ga0316574_0051739
277 Ga0316574_0154972
278 Ga0316582_0000025
279 Ga0316582_0002623
280 Ga0316582_0005432
281 Ga0316582_0055766
282 Ga0316582_0137483
283 Ga0316582_0358918
284 Ga0316584_0002621
285 Ga0316584_0005336
286 Ga0316584_0005357
287 Ga0316584_0011263
288 Ga0316584_0014580
289 Ga0316584_0025138
290 Ga0316584_0026836
291 Ga0316584_0030051
292 Ga0316584_0050562
293 Ga0316584_0069465
294 Ga0316584_0091873
295 Ga0316584_0092269
296 Ga0316584_0128005
297 Ga0316584_0248606
298 Ga0316584_0299251
299 Ga0436364_0984938
300 Ga0400483_076476
301 Ga0400483_089437
302 Ga0400483_212777
303 Ga0400483_258117
304 Ga0436365_1865259
305 Ga0451577_0003807
306 Ga0451577_0010718
307 Ga0451577_0017482
308 Ga0451577_0018795
309 Ga0453684_0037442
310 Ga0453684_0093146
311 Ga0451576_0001261
312 Ga0495668_0393806
313 Ga0495686_0172226
314 Ga0496107_0434645
315 Ga0496109_0549956
316 Ga0496109_0562038
317 Ga0496112_0121317
318 Ga0496115_0322129
319 Ga0496123_0049796
320 Ga0496124_0191068
321 Ga0501044_0020042
322 nmdc:mga0yw44_2439_c1
323 2643937307
324 2644318472
325 2644338222
326 2842336639
327 2894777048
328 8045864965

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07109

Mg-por_mtran_C

Magnesium-protoporphyrin IX methyltransferase C-terminus

142

242

0.98

PF08241

Methyltransf_11

Methyltransferase domain

77

162

0.91

PF03602

Cons_hypoth95

Conserved hypothetical protein 95

42

140

0.88

PF05175

MTS

Methyltransferase small domain

53

170

0.86

PF13649

Methyltransf_25

Methyltransferase domain

76

167

0.86

PF08242

Methyltransf_12

Methyltransferase domain

77

168

0.85

PF13847

Methyltransf_31

Methyltransferase domain

70

173

0.85

PF13489

Methyltransf_23

Methyltransferase domain

52

197

0.8

PF06325

PrmA

Ribosomal protein L11 methyltransferase (PrmA)

61

145

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qdj-assembly1.cif.gz_A crystal structure of magnesium protoporphyrin ix methyltransferase (chlm) from synechocystis pcc 6803 with bound sam 0.9163 9 233
4qdk-assembly2.cif.gz_A crystal structure of magnesium protoporphyrin ix methyltransferase (chlm) from synechocystis pcc 6803 with bound sah 0.902 9 233
4qdk-assembly2.cif.gz_A crystal structure of magnesium protoporphyrin ix methyltransferase (chlm) from synechocystis pcc 6803 with bound sah 0.8942 9 233
4qdj-assembly1.cif.gz_A crystal structure of magnesium protoporphyrin ix methyltransferase (chlm) from synechocystis pcc 6803 with bound sam 0.8869 9 233
4qdk-assembly2.cif.gz_B-2 crystal structure of magnesium protoporphyrin ix methyltransferase (chlm) from synechocystis pcc 6803 with bound sah 0.8856 10 233
ID Description Score Start End Superfamily
4qdjA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9163 9 233 3.40.50.150
4qdjA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8869 9 233 3.40.50.150
af_I1K6T6_92_324_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8671 9 233 3.40.50.150
af_K7MAL3_1_105_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8666 63 131 3.40.50.150
af_Q0DEV8_1_106_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8519 128 232 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A0D7EEL0-F1-model_v4 Magnesium protoporphyrin IX methyltransferase (EC 2.1.1.11) 0.9687 67 233 GO:0015995
GO:0046406
AF-A0A0N1LII5-F1-model_v4 Magnesium protoporphyrin IX methyltransferase (EC 2.1.1.11) 0.9632 14 233 GO:0015995
GO:0032259
GO:0046406
AF-A0A0D7EEL0-F1-model_v4 Magnesium protoporphyrin IX methyltransferase (EC 2.1.1.11) 0.963 67 233 GO:0015995
GO:0046406
AF-A0A258RNE6-F1-model_v4 Magnesium protoporphyrin IX methyltransferase (EC 2.1.1.11) 0.9582 6 233 GO:0015995
GO:0032259
GO:0046406
AF-A0A0N1LII5-F1-model_v4 Magnesium protoporphyrin IX methyltransferase (EC 2.1.1.11) 0.9546 14 233 GO:0015995
GO:0032259
GO:0046406

Map