F244218
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 164 | 79 | 328 | 233 |
Family's Representative Sequence
| Representative Sequence | 3300031727|Ga0316576_10113948|Ga0316576_101139482 |
| Length | 243 |
| Sequence | MGPNSTNETISMPSVSYQKRRGQIEAYFDRTAAEAWKRLTSDAPVSGIRATVRAGRDEMRKTLLGYLPADLNGKRLLDAGCGTGMLSLEAARRGATVYAVDLSPTLIANARERVPEELSGHIDYAVGDMLAPEQGEFDHIVAMDSLIHYELEDALNVIEGFASRARASVLFTFAPRTPALALMHAVGQFFPRSDRSPAIVPVAVDRLRGAIGAAPELSEWRVGRTQRISRGFYTSQAMELTRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 2 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 3 | 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Metagenome | Rhizosphere |
| 4 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 8 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 9 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 10 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 12 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 13 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 14 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 15 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 16 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 17 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 18 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 19 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 20 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 21 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 22 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 23 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 24 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 25 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 26 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 27 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 28 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 29 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 30 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 31 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 32 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 33 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 34 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 35 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 36 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 37 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 38 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 39 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 40 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 41 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 42 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 43 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 44 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 45 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 46 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 47 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 48 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 49 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 50 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 51 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 52 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 53 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 54 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 55 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 56 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 57 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 58 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 59 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 60 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 61 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 62 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 63 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 64 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 65 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 66 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 67 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 68 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 69 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 70 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 71 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 72 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 73 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 74 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 75 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 76 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 77 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 78 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 79 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.63 |
| Metatranscriptomes | 6.71 |
| Isolates | 3.66 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.22 |
| Nodule | 0.61 |
| Rhizoplane | 3.05 |
| Rhizosphere | 85.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0316576_10113948 | 3300031727 | Bacteria | 2028 |
| 2 | rootH1_10246377 | 3300003323 | Bacteria | 1724 |
| 3 | JGI26128J50194_1002030 | 3300003347 | Bacteria | 1313 |
| 4 | Ga0070669_100190261 | 3300005353 | Bacteria | 1610 |
| 5 | Ga0070667_100607151 | 3300005367 | Bacteria | 1008 |
| 6 | Ga0070665_100377833 | 3300005548 | Bacteria | 1424 |
| 7 | Ga0068863_100118162 | 3300005841 | Bacteria | 2527 |
| 8 | Ga0068858_100253735 | 3300005842 | Bacteria | 1671 |
| 9 | Ga0075365_10005379 | 3300006038 | Bacteria | 6897 |
| 10 | Ga0070712_100147186 | 3300006175 | Bacteria | 1804 |
| 11 | Ga0105243_10976493 | 3300009148 | Bacteria | 848 |
| 12 | Ga0105248_10177285 | 3300009177 | Bacteria | 2402 |
| 13 | Ga0105239_10306362 | 3300010375 | Bacteria | 1789 |
| 14 | Ga0157378_10018606 | 3300013297 | Bacteria | 6108 |
| 15 | Ga0163162_11511141 | 3300013306 | Bacteria | 765 |
| 16 | Ga0213876_10045582 | 3300021384 | Bacteria | 2318 |
| 17 | Ga0213875_10183593 | 3300021388 | Bacteria | 983 |
| 18 | Ga0207649_10339264 | 3300025920 | Bacteria | 1109 |
| 19 | Ga0207694_10373716 | 3300025924 | Bacteria | 1182 |
| 20 | Ga0207644_10788049 | 3300025931 | Bacteria | 795 |
| 21 | Ga0207703_10090452 | 3300026035 | Bacteria | 2572 |
| 22 | Ga0207639_10053999 | 3300026041 | Bacteria | 3069 |
| 23 | Ga0207702_10454130 | 3300026078 | Bacteria | 1244 |
| 24 | Ga0209968_1005091 | 3300027526 | Bacteria | 1971 |
| 25 | Ga0209966_1000013 | 3300027695 | Bacteria | 83121 |
| 26 | Ga0265337_1003714 | 3300028556 | Bacteria | 6525 |
| 27 | Ga0265326_10012690 | 3300028558 | Bacteria | 2471 |
| 28 | Ga0265319_1004858 | 3300028563 | Bacteria | 6577 |
| 29 | Ga0265334_10001855 | 3300028573 | Bacteria | 10057 |
| 30 | Ga0265334_10085879 | 3300028573 | Unclassified | 1154 |
| 31 | Ga0265323_10001594 | 3300028653 | Bacteria | 10940 |
| 32 | Ga0265322_10003363 | 3300028654 | Bacteria | 4843 |
| 33 | Ga0265336_10001303 | 3300028666 | Bacteria | 11675 |
| 34 | Ga0265338_10000081 | 3300028800 | Bacteria | 176402 |
| 35 | Ga0265324_10006214 | 3300029957 | Bacteria | 5026 |
| 36 | Ga0265332_10043671 | 3300031238 | Bacteria | 1935 |
| 37 | Ga0265328_10000102 | 3300031239 | Bacteria | 41869 |
| 38 | Ga0265328_10002882 | 3300031239 | Bacteria | 7674 |
| 39 | Ga0265325_10039459 | 3300031241 | Bacteria | 2487 |
| 40 | Ga0265329_10058331 | 3300031242 | Bacteria | 1223 |
| 41 | Ga0265340_10091810 | 3300031247 | Bacteria | 1418 |
| 42 | Ga0265331_10001308 | 3300031250 | Bacteria | 18466 |
| 43 | Ga0265327_10000613 | 3300031251 | Bacteria | 58852 |
| 44 | Ga0265327_10021226 | 3300031251 | Bacteria | 3924 |
| 45 | Ga0265327_10150351 | 3300031251 | Bacteria | 1081 |
| 46 | Ga0265316_10010270 | 3300031344 | Bacteria | 8542 |
| 47 | Ga0265316_10099461 | 3300031344 | Bacteria | 2212 |
| 48 | Ga0316575_10000918 | 3300031665 | Bacteria | 9060 |
| 49 | Ga0316575_10018043 | 3300031665 | Bacteria | 2687 |
| 50 | Ga0316575_10182558 | 3300031665 | Bacteria | 871 |
| 51 | Ga0316579_10000187 | 3300031691 | Bacteria | 18075 |
| 52 | Ga0316579_10004244 | 3300031691 | Bacteria | 5675 |
| 53 | Ga0316579_10007356 | 3300031691 | Bacteria | 4546 |
| 54 | Ga0316579_10051846 | 3300031691 | Bacteria | 1920 |
| 55 | Ga0265342_10117044 | 3300031712 | Bacteria | 1504 |
| 56 | Ga0316576_10001077 | 3300031727 | Bacteria | 14188 |
| 57 | Ga0316576_10001976 | 3300031727 | Bacteria | 11457 |
| 58 | Ga0316576_10007224 | 3300031727 | Bacteria | 6972 |
| 59 | Ga0316576_10024539 | 3300031727 | Bacteria | 4210 |
| 60 | Ga0316576_10027573 | 3300031727 | Bacteria | 3995 |
| 61 | Ga0316576_10156051 | 3300031727 | Bacteria | 1720 |
| 62 | Ga0316576_10198285 | 3300031727 | Bacteria | 1512 |
| 63 | Ga0316576_10213847 | 3300031727 | Bacteria | 1451 |
| 64 | Ga0316576_10311925 | 3300031727 | Bacteria | 1174 |
| 65 | Ga0316578_10000893 | 3300031728 | Bacteria | 11258 |
| 66 | Ga0316578_10001626 | 3300031728 | Bacteria | 9307 |
| 67 | Ga0316578_10002963 | 3300031728 | Bacteria | 7636 |
| 68 | Ga0316578_10024977 | 3300031728 | Bacteria | 3355 |
| 69 | Ga0316578_10032334 | 3300031728 | Bacteria | 2988 |
| 70 | Ga0316578_10041116 | 3300031728 | Bacteria | 2676 |
| 71 | Ga0316578_10048361 | 3300031728 | Bacteria | 2483 |
| 72 | Ga0316578_10054462 | 3300031728 | Bacteria | 2346 |
| 73 | Ga0316578_10089552 | 3300031728 | Bacteria | 1836 |
| 74 | Ga0316578_10190790 | 3300031728 | Bacteria | 1234 |
| 75 | Ga0316578_10221960 | 3300031728 | Bacteria | 1136 |
| 76 | Ga0316578_10290562 | 3300031728 | Bacteria | 978 |
| 77 | Ga0316577_10000604 | 3300031733 | Bacteria | 14818 |
| 78 | Ga0316577_10000984 | 3300031733 | Bacteria | 12723 |
| 79 | Ga0316577_10003065 | 3300031733 | Bacteria | 8387 |
| 80 | Ga0316577_10004906 | 3300031733 | Bacteria | 6969 |
| 81 | Ga0316577_10014347 | 3300031733 | Bacteria | 4348 |
| 82 | Ga0316577_10040167 | 3300031733 | Bacteria | 2617 |
| 83 | Ga0316577_10056017 | 3300031733 | Bacteria | 2200 |
| 84 | Ga0316577_10179922 | 3300031733 | Bacteria | 1194 |
| 85 | Ga0316583_10007981 | 3300032133 | Bacteria | 3815 |
| 86 | Ga0316583_10048668 | 3300032133 | Bacteria | 1492 |
| 87 | Ga0316585_10000076 | 3300032137 | Bacteria | 16627 |
| 88 | Ga0316585_10005593 | 3300032137 | Bacteria | 3553 |
| 89 | Ga0316585_10032785 | 3300032137 | Bacteria | 1637 |
| 90 | Ga0316585_10043842 | 3300032137 | Bacteria | 1428 |
| 91 | Ga0316580_10000517 | 3300032139 | Bacteria | 8904 |
| 92 | Ga0316580_10001555 | 3300032139 | Bacteria | 6051 |
| 93 | Ga0316580_10001759 | 3300032139 | Bacteria | 5788 |
| 94 | Ga0316580_10007972 | 3300032139 | Bacteria | 3165 |
| 95 | Ga0316593_10001023 | 3300032168 | Bacteria | 5797 |
| 96 | Ga0316593_10019676 | 3300032168 | Bacteria | 2089 |
| 97 | Ga0316592_1002850 | 3300033524 | Bacteria | 3040 |
| 98 | Ga0316592_1005216 | 3300033524 | Bacteria | 2456 |
| 99 | Ga0316588_1000004 | 3300033528 | Bacteria | 16160 |
| 100 | Ga0316588_1000087 | 3300033528 | Bacteria | 8414 |
| 101 | Ga0316588_1000344 | 3300033528 | Bacteria | 5964 |
| 102 | Ga0316588_1002102 | 3300033528 | Bacteria | 3417 |
| 103 | Ga0316588_1006619 | 3300033528 | Bacteria | 2323 |
| 104 | Ga0316588_1026752 | 3300033528 | Bacteria | 1337 |
| 105 | Ga0316596_1001115 | 3300033541 | Bacteria | 5242 |
| 106 | Ga0316574_0000045 | 3300035398 | Bacteria | 30677 |
| 107 | Ga0316574_0000719 | 3300035398 | Bacteria | 14168 |
| 108 | Ga0316574_0001681 | 3300035398 | Bacteria | 10678 |
| 109 | Ga0316574_0026028 | 3300035398 | Bacteria | 3517 |
| 110 | Ga0316574_0033643 | 3300035398 | Bacteria | 3120 |
| 111 | Ga0316574_0044264 | 3300035398 | Bacteria | 2753 |
| 112 | Ga0316574_0051739 | 3300035398 | Bacteria | 2560 |
| 113 | Ga0316574_0154972 | 3300035398 | Bacteria | 1476 |
| 114 | Ga0316582_0000025 | 3300036647 | Bacteria | 35921 |
| 115 | Ga0316582_0002623 | 3300036647 | Bacteria | 8518 |
| 116 | Ga0316582_0005432 | 3300036647 | Bacteria | 6564 |
| 117 | Ga0316582_0055766 | 3300036647 | Bacteria | 2519 |
| 118 | Ga0316582_0137483 | 3300036647 | Bacteria | 1645 |
| 119 | Ga0316582_0358918 | 3300036647 | Bacteria | 1003 |
| 120 | Ga0316584_0002621 | 3300036712 | Bacteria | 11464 |
| 121 | Ga0316584_0005336 | 3300036712 | Bacteria | 8614 |
| 122 | Ga0316584_0005357 | 3300036712 | Bacteria | 8604 |
| 123 | Ga0316584_0011263 | 3300036712 | Bacteria | 6278 |
| 124 | Ga0316584_0014580 | 3300036712 | Bacteria | 5600 |
| 125 | Ga0316584_0025138 | 3300036712 | Bacteria | 4365 |
| 126 | Ga0316584_0026836 | 3300036712 | Bacteria | 4236 |
| 127 | Ga0316584_0030051 | 3300036712 | Bacteria | 4012 |
| 128 | Ga0316584_0050562 | 3300036712 | Bacteria | 3108 |
| 129 | Ga0316584_0069465 | 3300036712 | Bacteria | 2641 |
| 130 | Ga0316584_0091873 | 3300036712 | Bacteria | 2272 |
| 131 | Ga0316584_0092269 | 3300036712 | Bacteria | 2267 |
| 132 | Ga0316584_0128005 | 3300036712 | Bacteria | 1896 |
| 133 | Ga0316584_0248606 | 3300036712 | Bacteria | 1299 |
| 134 | Ga0316584_0299251 | 3300036712 | Bacteria | 1165 |
| 135 | Ga0436364_0984938 | 3300037853 | Bacteria | 1237 |
| 136 | Ga0400483_076476 | 3300039062 | Bacteria | 10411 |
| 137 | Ga0400483_089437 | 3300039062 | Bacteria | 2944 |
| 138 | Ga0400483_212777 | 3300039062 | Bacteria | 18396 |
| 139 | Ga0400483_258117 | 3300039062 | Bacteria | 1683 |
| 140 | Ga0436365_1865259 | 3300039437 | Bacteria | 3076 |
| 141 | Ga0451577_0003807 | 3300042876 | Bacteria | 16426 |
| 142 | Ga0451577_0010718 | 3300042876 | Bacteria | 8727 |
| 143 | Ga0451577_0017482 | 3300042876 | Bacteria | 6624 |
| 144 | Ga0451577_0018795 | 3300042876 | Bacteria | 6358 |
| 145 | Ga0453684_0037442 | 3300044712 | Bacteria | 6658 |
| 146 | Ga0453684_0093146 | 3300044712 | Bacteria | 3712 |
| 147 | Ga0451576_0001261 | 3300045051 | Bacteria | 44384 |
| 148 | Ga0495668_0393806 | 3300046616 | Bacteria | 761 |
| 149 | Ga0495686_0172226 | 3300047472 | Bacteria | 1258 |
| 150 | Ga0496107_0434645 | 3300048910 | Unclassified | 976 |
| 151 | Ga0496109_0549956 | 3300048912 | Bacteria | 1089 |
| 152 | Ga0496109_0562038 | 3300048912 | Bacteria | 1076 |
| 153 | Ga0496112_0121317 | 3300048915 | Bacteria | 2584 |
| 154 | Ga0496115_0322129 | 3300048918 | Bacteria | 1264 |
| 155 | Ga0496123_0049796 | 3300048926 | Bacteria | 2805 |
| 156 | Ga0496124_0191068 | 3300048927 | Bacteria | 1567 |
| 157 | Ga0501044_0020042 | 3300049823 | Bacteria | 7141 |
| 158 | nmdc:mga0yw44_2439_c1 | 3300050492 | Bacteria | 7927 |
| 159 | 2643937307 | 2643221585 | Bacteria | 5812563 |
| 160 | 2644318472 | 2643221656 | Bacteria | 5809961 |
| 161 | 2644338222 | 2643221660 | Bacteria | 4208257 |
| 162 | 2842336639 | 2842333319 | Bacteria | 8899485 |
| 163 | 2894777048 | 2894772417 | Bacteria | 5305674 |
| 164 | 8045864965 | 8045864390 | Bacteria | 5043873 |
| 165 | Ga0316576_10113948 | |||
| 166 | rootH1_10246377 | |||
| 167 | JGI26128J50194_1002030 | |||
| 168 | Ga0070669_100190261 | |||
| 169 | Ga0070667_100607151 | |||
| 170 | Ga0070665_100377833 | |||
| 171 | Ga0068863_100118162 | |||
| 172 | Ga0068858_100253735 | |||
| 173 | Ga0075365_10005379 | |||
| 174 | Ga0070712_100147186 | |||
| 175 | Ga0105243_10976493 | |||
| 176 | Ga0105248_10177285 | |||
| 177 | Ga0105239_10306362 | |||
| 178 | Ga0157378_10018606 | |||
| 179 | Ga0163162_11511141 | |||
| 180 | Ga0213876_10045582 | |||
| 181 | Ga0213875_10183593 | |||
| 182 | Ga0207649_10339264 | |||
| 183 | Ga0207694_10373716 | |||
| 184 | Ga0207644_10788049 | |||
| 185 | Ga0207703_10090452 | |||
| 186 | Ga0207639_10053999 | |||
| 187 | Ga0207702_10454130 | |||
| 188 | Ga0209968_1005091 | |||
| 189 | Ga0209966_1000013 | |||
| 190 | Ga0265337_1003714 | |||
| 191 | Ga0265326_10012690 | |||
| 192 | Ga0265319_1004858 | |||
| 193 | Ga0265334_10001855 | |||
| 194 | Ga0265334_10085879 | |||
| 195 | Ga0265323_10001594 | |||
| 196 | Ga0265322_10003363 | |||
| 197 | Ga0265336_10001303 | |||
| 198 | Ga0265338_10000081 | |||
| 199 | Ga0265324_10006214 | |||
| 200 | Ga0265332_10043671 | |||
| 201 | Ga0265328_10000102 | |||
| 202 | Ga0265328_10002882 | |||
| 203 | Ga0265325_10039459 | |||
| 204 | Ga0265329_10058331 | |||
| 205 | Ga0265340_10091810 | |||
| 206 | Ga0265331_10001308 | |||
| 207 | Ga0265327_10000613 | |||
| 208 | Ga0265327_10021226 | |||
| 209 | Ga0265327_10150351 | |||
| 210 | Ga0265316_10010270 | |||
| 211 | Ga0265316_10099461 | |||
| 212 | Ga0316575_10000918 | |||
| 213 | Ga0316575_10018043 | |||
| 214 | Ga0316575_10182558 | |||
| 215 | Ga0316579_10000187 | |||
| 216 | Ga0316579_10004244 | |||
| 217 | Ga0316579_10007356 | |||
| 218 | Ga0316579_10051846 | |||
| 219 | Ga0265342_10117044 | |||
| 220 | Ga0316576_10001077 | |||
| 221 | Ga0316576_10001976 | |||
| 222 | Ga0316576_10007224 | |||
| 223 | Ga0316576_10024539 | |||
| 224 | Ga0316576_10027573 | |||
| 225 | Ga0316576_10156051 | |||
| 226 | Ga0316576_10198285 | |||
| 227 | Ga0316576_10213847 | |||
| 228 | Ga0316576_10311925 | |||
| 229 | Ga0316578_10000893 | |||
| 230 | Ga0316578_10001626 | |||
| 231 | Ga0316578_10002963 | |||
| 232 | Ga0316578_10024977 | |||
| 233 | Ga0316578_10032334 | |||
| 234 | Ga0316578_10041116 | |||
| 235 | Ga0316578_10048361 | |||
| 236 | Ga0316578_10054462 | |||
| 237 | Ga0316578_10089552 | |||
| 238 | Ga0316578_10190790 | |||
| 239 | Ga0316578_10221960 | |||
| 240 | Ga0316578_10290562 | |||
| 241 | Ga0316577_10000604 | |||
| 242 | Ga0316577_10000984 | |||
| 243 | Ga0316577_10003065 | |||
| 244 | Ga0316577_10004906 | |||
| 245 | Ga0316577_10014347 | |||
| 246 | Ga0316577_10040167 | |||
| 247 | Ga0316577_10056017 | |||
| 248 | Ga0316577_10179922 | |||
| 249 | Ga0316583_10007981 | |||
| 250 | Ga0316583_10048668 | |||
| 251 | Ga0316585_10000076 | |||
| 252 | Ga0316585_10005593 | |||
| 253 | Ga0316585_10032785 | |||
| 254 | Ga0316585_10043842 | |||
| 255 | Ga0316580_10000517 | |||
| 256 | Ga0316580_10001555 | |||
| 257 | Ga0316580_10001759 | |||
| 258 | Ga0316580_10007972 | |||
| 259 | Ga0316593_10001023 | |||
| 260 | Ga0316593_10019676 | |||
| 261 | Ga0316592_1002850 | |||
| 262 | Ga0316592_1005216 | |||
| 263 | Ga0316588_1000004 | |||
| 264 | Ga0316588_1000087 | |||
| 265 | Ga0316588_1000344 | |||
| 266 | Ga0316588_1002102 | |||
| 267 | Ga0316588_1006619 | |||
| 268 | Ga0316588_1026752 | |||
| 269 | Ga0316596_1001115 | |||
| 270 | Ga0316574_0000045 | |||
| 271 | Ga0316574_0000719 | |||
| 272 | Ga0316574_0001681 | |||
| 273 | Ga0316574_0026028 | |||
| 274 | Ga0316574_0033643 | |||
| 275 | Ga0316574_0044264 | |||
| 276 | Ga0316574_0051739 | |||
| 277 | Ga0316574_0154972 | |||
| 278 | Ga0316582_0000025 | |||
| 279 | Ga0316582_0002623 | |||
| 280 | Ga0316582_0005432 | |||
| 281 | Ga0316582_0055766 | |||
| 282 | Ga0316582_0137483 | |||
| 283 | Ga0316582_0358918 | |||
| 284 | Ga0316584_0002621 | |||
| 285 | Ga0316584_0005336 | |||
| 286 | Ga0316584_0005357 | |||
| 287 | Ga0316584_0011263 | |||
| 288 | Ga0316584_0014580 | |||
| 289 | Ga0316584_0025138 | |||
| 290 | Ga0316584_0026836 | |||
| 291 | Ga0316584_0030051 | |||
| 292 | Ga0316584_0050562 | |||
| 293 | Ga0316584_0069465 | |||
| 294 | Ga0316584_0091873 | |||
| 295 | Ga0316584_0092269 | |||
| 296 | Ga0316584_0128005 | |||
| 297 | Ga0316584_0248606 | |||
| 298 | Ga0316584_0299251 | |||
| 299 | Ga0436364_0984938 | |||
| 300 | Ga0400483_076476 | |||
| 301 | Ga0400483_089437 | |||
| 302 | Ga0400483_212777 | |||
| 303 | Ga0400483_258117 | |||
| 304 | Ga0436365_1865259 | |||
| 305 | Ga0451577_0003807 | |||
| 306 | Ga0451577_0010718 | |||
| 307 | Ga0451577_0017482 | |||
| 308 | Ga0451577_0018795 | |||
| 309 | Ga0453684_0037442 | |||
| 310 | Ga0453684_0093146 | |||
| 311 | Ga0451576_0001261 | |||
| 312 | Ga0495668_0393806 | |||
| 313 | Ga0495686_0172226 | |||
| 314 | Ga0496107_0434645 | |||
| 315 | Ga0496109_0549956 | |||
| 316 | Ga0496109_0562038 | |||
| 317 | Ga0496112_0121317 | |||
| 318 | Ga0496115_0322129 | |||
| 319 | Ga0496123_0049796 | |||
| 320 | Ga0496124_0191068 | |||
| 321 | Ga0501044_0020042 | |||
| 322 | nmdc:mga0yw44_2439_c1 | |||
| 323 | 2643937307 | |||
| 324 | 2644318472 | |||
| 325 | 2644338222 | |||
| 326 | 2842336639 | |||
| 327 | 2894777048 | |||
| 328 | 8045864965 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4qdj-assembly1.cif.gz_A | crystal structure of magnesium protoporphyrin ix methyltransferase (chlm) from synechocystis pcc 6803 with bound sam | 0.9163 | 9 | 233 |
| 4qdk-assembly2.cif.gz_A | crystal structure of magnesium protoporphyrin ix methyltransferase (chlm) from synechocystis pcc 6803 with bound sah | 0.902 | 9 | 233 |
| 4qdk-assembly2.cif.gz_A | crystal structure of magnesium protoporphyrin ix methyltransferase (chlm) from synechocystis pcc 6803 with bound sah | 0.8942 | 9 | 233 |
| 4qdj-assembly1.cif.gz_A | crystal structure of magnesium protoporphyrin ix methyltransferase (chlm) from synechocystis pcc 6803 with bound sam | 0.8869 | 9 | 233 |
| 4qdk-assembly2.cif.gz_B-2 | crystal structure of magnesium protoporphyrin ix methyltransferase (chlm) from synechocystis pcc 6803 with bound sah | 0.8856 | 10 | 233 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4qdjA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9163 | 9 | 233 | 3.40.50.150 |
| 4qdjA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8869 | 9 | 233 | 3.40.50.150 |
| af_I1K6T6_92_324_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8671 | 9 | 233 | 3.40.50.150 |
| af_K7MAL3_1_105_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8666 | 63 | 131 | 3.40.50.150 |
| af_Q0DEV8_1_106_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8519 | 128 | 232 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0D7EEL0-F1-model_v4 | Magnesium protoporphyrin IX methyltransferase (EC 2.1.1.11) | 0.9687 | 67 | 233 |
GO:0015995
GO:0046406 |
| AF-A0A0N1LII5-F1-model_v4 | Magnesium protoporphyrin IX methyltransferase (EC 2.1.1.11) | 0.9632 | 14 | 233 |
GO:0015995
GO:0032259 GO:0046406 |
| AF-A0A0D7EEL0-F1-model_v4 | Magnesium protoporphyrin IX methyltransferase (EC 2.1.1.11) | 0.963 | 67 | 233 |
GO:0015995
GO:0046406 |
| AF-A0A258RNE6-F1-model_v4 | Magnesium protoporphyrin IX methyltransferase (EC 2.1.1.11) | 0.9582 | 6 | 233 |
GO:0015995
GO:0032259 GO:0046406 |
| AF-A0A0N1LII5-F1-model_v4 | Magnesium protoporphyrin IX methyltransferase (EC 2.1.1.11) | 0.9546 | 14 | 233 |
GO:0015995
GO:0032259 GO:0046406 |