F242972

General Info

Members Datasets Scaffolds Average Seq Length
164 112 159 227

Family's Representative Sequence

Representative Sequence 3300004625|Ga0055543_1006202|Ga0055543_10062022
Length 267
Sequence MSTPNASPHRAASRPAIQDPRAIPVTGTDAHLPAVPRERLTPEWLRERFLHPVAFDPELPGDGGLFPGRTTTQAAVLIALVQRAEGLHVLLTQRTAHLRDHAGQISFPGGRAEPEDGSPERTALREAEEEIGLDEGFVDLIGQLPVYRTVTAYEVTPVVALIRPGFSLRLDAFEVAEAFEVPLEFLMDPAHHQRHTFEYEAGNDVPGGEDGPLKGRRQFLSMPWTGPGLAVSNADPDASLAPGQSKEFFIWGATAAMLRNLYRFLQV

Samples

Sample ID Description Type Environment
1 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
2 2643221585 Pelomonas sp. Root662 Isolate Unclassified
3 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
4 2643221656 Pelomonas sp. Root405 Isolate Unclassified
5 2738541337 Pelomonas sp. BT06 Isolate Unclassified
6 2831864461 Roseateles noduli HZ7 Isolate Nodule
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
40 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
41 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
45 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
46 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
57 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
58 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
59 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
60 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
61 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
62 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
63 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
64 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
65 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
66 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
67 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
68 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
69 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
70 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
71 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
72 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
73 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
74 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
75 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
76 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
77 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
78 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
79 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
80 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
81 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
82 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
83 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
84 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
85 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
86 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
87 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
88 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
89 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
90 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
91 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
92 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
93 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
94 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
95 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
96 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
97 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
99 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
100 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
101 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
102 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
103 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
104 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
105 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
106 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
107 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
108 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
109 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
110 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
111 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
112 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.34
Metatranscriptomes 0
Isolates 3.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.61
Nodule 1.83
Rhizoplane 3.05
Rhizosphere 57.32
Stem 0
Stem Tuber 0
Unclassified 12.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10088076 3300003316 Bacteria 1140
2 rootH2_10018306 3300003320 Bacteria 3899
3 rootH2_10074771 3300003320 Bacteria 1263
4 rootL2_10001570 3300003322 Bacteria 58042
5 rootL2_10029841 3300003322 Bacteria 11328
6 rootH1_10011835 3300003316 Bacteria 41523
7 rootH1_10011835 3300003323 Bacteria 10028
8 Ga0055529_1000967 3300003763 Bacteria 14632
9 Ga0055526_1005939 3300003771 Bacteria 6808
10 Ga0055524_1001066 3300003775 Bacteria 16853
11 Ga0055531_10000060 3300003794 Bacteria 120626
12 Ga0055531_10007047 3300003794 Bacteria 6222
13 Ga0055531_10009689 3300003794 Bacteria 4896
14 Ga0055543_1006202 3300004625 Bacteria 2926
15 Ga0065165_1000151 3300005262 Bacteria 120917
16 Ga0065165_1000166 3300005262 Bacteria 115866
17 Ga0070671_100006769 3300005355 Bacteria 9168
18 Ga0070708_100218949 3300005445 Bacteria 1785
19 Ga0068853_100140396 3300005539 Bacteria 2168
20 Ga0070665_100373095 3300005548 Bacteria 1434
21 Ga0068856_100034384 3300005614 Bacteria 4964
22 Ga0068864_100110693 3300005618 Bacteria 2446
23 Ga0068858_100495572 3300005842 Bacteria 1180
24 Ga0075366_10004514 3300006195 Bacteria 7468
25 Ga0075366_10037065 3300006195 Bacteria 2877
26 Ga0075366_10191242 3300006195 Bacteria 1244
27 Ga0075366_10211087 3300006195 Bacteria 1182
28 Ga0075366_10236430 3300006195 Bacteria 1114
29 Ga0097621_100414420 3300006237 Bacteria 1208
30 Ga0075430_100000403 3300006846 Bacteria 32016
31 Ga0075429_100356395 3300006880 Bacteria 1281
32 Ga0099823_1000519 3300006944 Bacteria 26178
33 Ga0105240_10197086 3300009093 Bacteria 2363
34 Ga0114129_10079228 3300009147 Bacteria 4568
35 Ga0105243_10241934 3300009148 Bacteria 1606
36 Ga0105248_10003694 3300009177 Bacteria 16961
37 Ga0105237_10001352 3300009545 Bacteria 32488
38 Ga0105238_10096293 3300009551 Bacteria 2946
39 Ga0099796_10002949 3300010159 Bacteria 3851
40 Ga0105239_10003766 3300010375 Bacteria 18446
41 Ga0157319_1000010 3300012497 Bacteria 197331
42 Ga0163163_10594663 3300014325 Bacteria 1170
43 Ga0157379_10235876 3300014968 Bacteria 1659
44 Ga0213872_10000140 3300021361 Bacteria 65308
45 Ga0209672_114909 3300025228 Bacteria 885
46 Ga0209258_112693 3300025242 Bacteria 1025
47 Ga0209455_1000288 3300025272 Bacteria 53979
48 Ga0209673_1038913 3300025273 Bacteria 1379
49 Ga0209564_1000003 3300025295 Bacteria 1585848
50 Ga0209050_1002810 3300025298 Bacteria 13906
51 Ga0209256_1000204 3300025299 Bacteria 112000
52 Ga0209051_1000740 3300025303 Bacteria 35260
53 Ga0209051_1001366 3300025303 Bacteria 21088
54 Ga0209257_1000103 3300025304 Bacteria 245859
55 Ga0209257_1001275 3300025304 Bacteria 30852
56 Ga0209257_1002884 3300025304 Bacteria 15980
57 Ga0207695_10098807 3300025913 Bacteria 2918
58 Ga0207671_10009654 3300025914 Bacteria 8043
59 Ga0207694_10133800 3300025924 Bacteria 1989
60 Ga0207709_10119380 3300025935 Bacteria 1778
61 Ga0207703_10461467 3300026035 Bacteria 1188
62 Ga0207676_10346620 3300026095 Bacteria 1372
63 Ga0209389_1002367 3300027296 Bacteria 14389
64 Ga0307515_10000020 3300028794 Bacteria 411735
65 Ga0307515_10000525 3300028794 Bacteria 91297
66 Ga0265324_10026445 3300029957 Bacteria 2054
67 Ga0265328_10011051 3300031239 Bacteria 3617
68 Ga0265325_10006618 3300031241 Bacteria 7015
69 Ga0265327_10000083 3300031251 Bacteria 204923
70 Ga0265327_10095807 3300031251 Bacteria 1440
71 Ga0265316_10359174 3300031344 Bacteria 1053
72 Ga0307513_10034000 3300031456 Bacteria 5725
73 Ga0307509_10029450 3300031507 Bacteria 6094
74 Ga0307412_10242777 3300031911 Bacteria 1394
75 Ga0373939_0000092 3300035114 Bacteria 28418
76 Ga0373960_0007446 3300035121 Bacteria 2593
77 Ga0373962_0007623 3300035242 Bacteria 2653
78 Ga0373931_0000403 3300035691 Bacteria 17660
79 Ga0373937_0027185 3300036401 Bacteria 5172
80 Ga0395905_0007537 3300037471 Bacteria 10820
81 Ga0436361_0174497 3300039447 Bacteria 7261
82 Ga0436361_0240406 3300039447 Bacteria 1550
83 Ga0436361_0955941 3300039447 Bacteria 18402
84 Ga0451853_3425588 3300041512 Bacteria 1047
85 Ga0450888_000120 3300042126 Bacteria 6275
86 Ga0450890_002181 3300042127 Bacteria 2727
87 Ga0450891_001515 3300042129 Bacteria 2395
88 Ga0450892_001344 3300042130 Bacteria 2456
89 Ga0450902_010007 3300042137 Bacteria 1498
90 Ga0450916_011254 3300042530 Bacteria 1128
91 Ga0450893_0001121 3300042532 Bacteria 4028
92 Ga0450901_007919 3300042533 Bacteria 1094
93 Ga0451577_0000635 3300042876 Bacteria 56126
94 Ga0451577_0003419 3300042876 Bacteria 17701
95 Ga0451577_0018918 3300042876 Bacteria 6342
96 Ga0451577_0027799 3300042876 Bacteria 5119
97 Ga0451577_0095404 3300042876 Bacteria 2656
98 Ga0451577_0203052 3300042876 Bacteria 1789
99 Ga0453683_0033268 3300044673 Bacteria 3251
100 Ga0453683_0035450 3300044673 Bacteria 3144
101 Ga0453683_0197645 3300044673 Bacteria 1277
102 Ga0453683_0475926 3300044673 Bacteria 809
103 Ga0453684_0000005 3300044712 Bacteria 1431632
104 Ga0453684_0000069 3300044712 Bacteria 456439
105 Ga0453684_0000102 3300044712 Bacteria 366870
106 Ga0453684_0000459 3300044712 Bacteria 163142
107 Ga0453684_0002888 3300044712 Bacteria 40310
108 Ga0453684_0008512 3300044712 Bacteria 18337
109 Ga0453684_0036600 3300044712 Bacteria 6761
110 Ga0453684_0056665 3300044712 Bacteria 5081
111 Ga0453684_0076928 3300044712 Bacteria 4187
112 Ga0453684_0424562 3300044712 Bacteria 1484
113 Ga0453684_0442483 3300044712 Bacteria 1448
114 Ga0453684_0494403 3300044712 Bacteria 1355
115 Ga0453684_1036339 3300044712 Bacteria 870
116 Ga0466960_0019023 3300044901 Bacteria 3019
117 Ga0451576_0000418 3300045051 Bacteria 98732
118 Ga0451576_0004811 3300045051 Bacteria 17299
119 Ga0451576_0012922 3300045051 Bacteria 9357
120 Ga0451576_0040655 3300045051 Bacteria 4919
121 Ga0451576_0045331 3300045051 Bacteria 4632
122 Ga0451576_0061264 3300045051 Bacteria 3924
123 Ga0451576_0097579 3300045051 Bacteria 3056
124 Ga0451576_0099863 3300045051 Bacteria 3019
125 Ga0451576_0135714 3300045051 Bacteria 2565
126 Ga0451576_0258003 3300045051 Bacteria 1822
127 Ga0451576_0364876 3300045051 Bacteria 1513
128 Ga0495672_0074183 3300047320 Bacteria 1917
129 Ga0496102_0072747 3300048905 Bacteria 3160
130 Ga0496104_0027047 3300048907 Bacteria 5305
131 Ga0496110_0128764 3300048913 Bacteria 2285
132 Ga0496111_0225389 3300048914 Bacteria 1392
133 Ga0496112_0004102 3300048915 Bacteria 12246
134 Ga0496123_0196639 3300048926 Bacteria 1038
135 Ga0496124_0017697 3300048927 Bacteria 6707
136 Ga0496126_0033887 3300048929 Bacteria 4803
137 Ga0496126_0142121 3300048929 Bacteria 2065
138 Ga0501071_0341412 3300049587 Bacteria 1139
139 Ga0501035_0028357 3300049822 Bacteria 5111
140 Ga0501035_0034177 3300049822 Bacteria 4621
141 Ga0501044_0000396 3300049823 Bacteria 54058
142 nmdc:mga03683_67850_c1 3300050489 Bacteria 1519
143 nmdc:mga0k408_139307_c1 3300050493 Bacteria 1442
144 nmdc:mga0k408_25890_c1 3300050493 Bacteria 3324
145 nmdc:mga0k408_650_c1 3300050493 Bacteria 19163
146 nmdc:mga07m45_2978_c1 3300050496 Bacteria 8062
147 nmdc:mga07m45_4081_c1 3300050496 Bacteria 3292
148 nmdc:mga07m45_85282_c1 3300050496 Bacteria 1806
149 nmdc:mga05p37_598601_c1 3300050507 Bacteria 1245
150 Ga0500583_0096390 3300053092 Bacteria 1444
151 Ga0500607_021510 3300053121 Bacteria 3635
152 Ga0500658_0113493 3300053134 Bacteria 1195
153 Ga0500588_0042273 3300053146 Bacteria 1379
154 Ga0500622_0000958 3300053156 Bacteria 24497
155 Ga0500636_0000128 3300053177 Bacteria 39607
156 Ga0500637_0156331 3300053178 Bacteria 1315
157 Ga0500625_008520 3300053729 Bacteria 4533
158 Ga0500645_099336 3300053730 Bacteria 822
159 Ga0501082_0361241 3300060353 Bacteria 1267

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_0027799 Ga0451577_0027799_2180_2749 188
2 3300044673 Ga0453683_0033268 Ga0453683_0033268_445_1014 188
3 3300044712 Ga0453684_0442483 Ga0453684_0442483_100_669 188
4 3300044712 Ga0453684_0494403 Ga0453684_0494403_402_971 188
5 3300044712 Ga0453684_0000459 Ga0453684_0000459_11672_12253 190
6 3300031251 Ga0265327_10095807 Ga0265327_100958072 192
7 3300029957 Ga0265324_10026445 Ga0265324_100264453 193
8 3300031241 Ga0265325_10006618 Ga0265325_100066185 193
9 3300031344 Ga0265316_10359174 Ga0265316_103591742 193
10 3300044673 Ga0453683_0035450 Ga0453683_0035450_1285_1869 193
11 3300044712 Ga0453684_0002888 Ga0453684_0002888_2674_3258 193
12 3300045051 Ga0451576_0000418 Ga0451576_0000418_48397_48981 193
13 3300042876 Ga0451577_0000635 Ga0451577_0000635_52053_52640 194
14 3300044712 Ga0453684_0000005 Ga0453684_0000005_1146594_1147181 194
15 3300044712 Ga0453684_0000102 Ga0453684_0000102_55782_56369 194
16 3300044712 Ga0453684_0076928 Ga0453684_0076928_1478_2068 194
17 3300045051 Ga0451576_0099863 Ga0451576_0099863_2266_2895 194
18 3300042876 Ga0451577_0095404 Ga0451577_0095404_772_1365 195
19 3300044712 Ga0453684_0000069 Ga0453684_0000069_273449_274042 195
20 3300045051 Ga0451576_0012922 Ga0451576_0012922_5152_5745 195
21 3300044901 Ga0466960_0019023 Ga0466960_0019023_1227_1841 196
22 3300045051 Ga0451576_0045331 Ga0451576_0045331_1844_2449 196
23 3300045051 Ga0451576_0061264 Ga0451576_0061264_2913_3509 196
24 3300053121 Ga0500607_021510 Ga0500607_021510_2395_3018 199
25 3300053177 Ga0500636_0000128 Ga0500636_0000128_8193_8816 199
26 3300053178 Ga0500637_0156331 Ga0500637_0156331_328_951 199
27 3300053729 Ga0500625_008520 Ga0500625_008520_3471_4094 199
28 3300006237 Ga0097621_100414420 Ga0097621_1004144201 200
29 3300003771 Ga0055526_1005939 Ga0055526_10059394 201
30 3300003794 Ga0055531_10007047 Ga0055531_100070471 201
31 3300025273 Ga0209673_1038913 Ga0209673_10389132 201
32 3300025295 Ga0209564_1000003 Ga0209564_1000003813 201
33 3300025298 Ga0209050_1002810 Ga0209050_100281016 201
34 3300025303 Ga0209051_1000740 Ga0209051_100074025 201
35 3300025304 Ga0209257_1002884 Ga0209257_10028846 201
36 3300060353 Ga0501082_0361241 Ga0501082_0361241_497_1147 202
37 3300044712 Ga0453684_0008512 Ga0453684_0008512_1845_2474 203
38 3300053092 Ga0500583_0096390 Ga0500583_0096390_375_1040 203
39 3300053134 Ga0500658_0113493 Ga0500658_0113493_491_1156 203
40 3300053146 Ga0500588_0042273 Ga0500588_0042273_245_910 203
41 3300048929 Ga0496126_0033887 Ga0496126_0033887_462_1118 204
42 3300039447 Ga0436361_0174497 Ga0436361_0174497_1022_1690 211
43 3300047320 Ga0495672_0074183 Ga0495672_0074183_440_1093 213
44 3300053730 Ga0500645_099336 Ga0500645_099336_115_768 213
45 3300006846 Ga0075430_100000403 Ga0075430_10000040318 214
46 3300006880 Ga0075429_100356395 Ga0075429_1003563951 214
47 3300049822 Ga0501035_0034177 Ga0501035_0034177_123_851 214
48 3300050493 nmdc:mga0k408_139307_c1 nmdc:mga0k408_139307_c1_371_1069 214
49 3300005539 Ga0068853_100140396 Ga0068853_1001403962 215
50 3300006195 Ga0075366_10037065 Ga0075366_100370652 215
51 3300005445 Ga0070708_100218949 Ga0070708_1002189492 216
52 3300010159 Ga0099796_10002949 Ga0099796_100029494 217
53 3300049822 Ga0501035_0028357 Ga0501035_0028357_4227_4916 219
54 3300049823 Ga0501044_0000396 Ga0501044_0000396_29334_30023 219
55 3300042876 Ga0451577_0203052 Ga0451577_0203052_631_1356 220
56 3300044712 Ga0453684_1036339 Ga0453684_1036339_22_747 220
57 3300005355 Ga0070671_100006769 Ga0070671_1000067692 221
58 3300005618 Ga0068864_100110693 Ga0068864_1001106932 221
59 3300009177 Ga0105248_10003694 Ga0105248_1000369414 221
60 3300026095 Ga0207676_10346620 Ga0207676_103466202 221
61 3300048905 Ga0496102_0072747 Ga0496102_0072747_1381_2064 221
62 3300048907 Ga0496104_0027047 Ga0496104_0027047_3060_3743 221
63 3300048913 Ga0496110_0128764 Ga0496110_0128764_97_780 221
64 3300048914 Ga0496111_0225389 Ga0496111_0225389_153_836 221
65 3300048915 Ga0496112_0004102 Ga0496112_0004102_4607_5290 221
66 3300003763 Ga0055529_1000967 Ga0055529_100096715 222
67 3300025228 Ga0209672_114909 Ga0209672_1149091 222
68 3300025242 Ga0209258_112693 Ga0209258_1126932 222
69 3300025272 Ga0209455_1000288 Ga0209455_100028840 222
70 3300028794 Ga0307515_10000020 Ga0307515_1000002016 222
71 3300028794 Ga0307515_10000525 Ga0307515_1000052541 222
72 3300031456 Ga0307513_10034000 Ga0307513_100340003 222
73 iso_pu_bacteria 2643221544 2643746868 223
74 iso_pu_bacteria 2643221585 2643935594 223
75 iso_pu_bacteria 2643221639 2644221057 223
76 iso_pu_bacteria 2643221656 2644317377 223
77 iso_pu_bacteria 2738541337 2739057560 223
78 3300031239 Ga0265328_10011051 Ga0265328_100110515 224
79 3300031251 Ga0265327_10000083 Ga0265327_10000083161 224
80 3300048926 Ga0496123_0196639 Ga0496123_0196639_93_782 224
81 3300031911 Ga0307412_10242777 Ga0307412_102427773 225
82 3300042876 Ga0451577_0018918 Ga0451577_0018918_1125_1823 225
83 3300044673 Ga0453683_0475926 Ga0453683_0475926_17_706 225
84 3300044712 Ga0453684_0056665 Ga0453684_0056665_994_1692 225
85 3300044712 Ga0453684_0424562 Ga0453684_0424562_720_1409 225
86 3300045051 Ga0451576_0004811 Ga0451576_0004811_10887_11576 225
87 3300045051 Ga0451576_0135714 Ga0451576_0135714_1239_1937 225
88 3300003320 rootH2_10018306 rootH2_100183065 226
89 3300003320 rootH2_10074771 rootH2_100747712 226
90 3300003322 rootL2_10001570 rootL2_1000157015 226
91 3300003323 rootH1_10011835 rootH1_100118352 226
92 3300003775 Ga0055524_1001066 Ga0055524_100106610 226
93 3300003794 Ga0055531_10009689 Ga0055531_100096898 226
94 3300004625 Ga0055543_1006202 Ga0055543_10062022 226
95 3300005262 Ga0065165_1000151 Ga0065165_100015181 226
96 3300005262 Ga0065165_1000166 Ga0065165_100016616 226
97 3300005548 Ga0070665_100373095 Ga0070665_1003730952 226
98 3300005842 Ga0068858_100495572 Ga0068858_1004955722 226
99 3300006195 Ga0075366_10004514 Ga0075366_100045147 226
100 3300006195 Ga0075366_10211087 Ga0075366_102110872 226
101 3300006944 Ga0099823_1000519 Ga0099823_100051924 226
102 3300009093 Ga0105240_10197086 Ga0105240_101970862 226
103 3300009147 Ga0114129_10079228 Ga0114129_100792285 226
104 3300009545 Ga0105237_10001352 Ga0105237_1000135231 226
105 3300009551 Ga0105238_10096293 Ga0105238_100962933 226
106 3300010375 Ga0105239_10003766 Ga0105239_100037662 226
107 3300012497 Ga0157319_1000010 Ga0157319_100001094 226
108 3300014325 Ga0163163_10594663 Ga0163163_105946632 226
109 3300014968 Ga0157379_10235876 Ga0157379_102358762 226
110 3300021361 Ga0213872_10000140 Ga0213872_1000014033 226
111 3300025299 Ga0209256_1000204 Ga0209256_100020411 226
112 3300025304 Ga0209257_1001275 Ga0209257_100127526 226
113 3300025913 Ga0207695_10098807 Ga0207695_100988073 226
114 3300025914 Ga0207671_10009654 Ga0207671_100096548 226
115 3300025924 Ga0207694_10133800 Ga0207694_101338002 226
116 3300026035 Ga0207703_10461467 Ga0207703_104614672 226
117 3300027296 Ga0209389_1002367 Ga0209389_10023676 226
118 3300031507 Ga0307509_10029450 Ga0307509_100294506 226
119 3300036401 Ga0373937_0027185 Ga0373937_0027185_2408_3103 226
120 3300039447 Ga0436361_0240406 Ga0436361_0240406_421_1116 226
121 3300039447 Ga0436361_0955941 Ga0436361_0955941_17285_17992 226
122 3300041512 Ga0451853_3425588 Ga0451853_3425588_179_886 226
123 3300042127 Ga0450890_002181 Ga0450890_002181_1750_2520 226
124 3300042876 Ga0451577_0003419 Ga0451577_0003419_11808_12506 226
125 3300044673 Ga0453683_0197645 Ga0453683_0197645_388_1083 226
126 3300044712 Ga0453684_0036600 Ga0453684_0036600_5683_6378 226
127 3300045051 Ga0451576_0097579 Ga0451576_0097579_1805_2500 226
128 3300045051 Ga0451576_0258003 Ga0451576_0258003_785_1480 226
129 3300045051 Ga0451576_0364876 Ga0451576_0364876_629_1324 226
130 3300048927 Ga0496124_0017697 Ga0496124_0017697_1892_2674 226
131 3300048929 Ga0496126_0142121 Ga0496126_0142121_907_1683 226
132 3300049587 Ga0501071_0341412 Ga0501071_0341412_183_878 226
133 3300050489 nmdc:mga03683_67850_c1 nmdc:mga03683_67850_c1_203_904 226
134 3300050493 nmdc:mga0k408_25890_c1 nmdc:mga0k408_25890_c1_847_1542 226
135 3300050493 nmdc:mga0k408_650_c1 nmdc:mga0k408_650_c1_9028_9729 226
136 3300050496 nmdc:mga07m45_4081_c1 nmdc:mga07m45_4081_c1_2483_3253 226
137 3300050507 nmdc:mga05p37_598601_c1 nmdc:mga05p37_598601_c1_221_916 226
138 3300053156 Ga0500622_0000958 Ga0500622_0000958_23621_24439 226
139 iso_pu_bacteria 2831864461 2831868395 226
140 3300003316 rootH1_10088076 rootH1_100880761 227
141 3300003322 rootL2_10029841 rootL2_100298411 227
142 3300003794 Ga0055531_10000060 Ga0055531_1000006049 227
143 3300005614 Ga0068856_100034384 Ga0068856_1000343845 227
144 3300006195 Ga0075366_10191242 Ga0075366_101912421 227
145 3300006195 Ga0075366_10236430 Ga0075366_102364302 227
146 3300009148 Ga0105243_10241934 Ga0105243_102419342 227
147 3300025303 Ga0209051_1001366 Ga0209051_100136617 227
148 3300025304 Ga0209257_1000103 Ga0209257_1000103118 227
149 3300025935 Ga0207709_10119380 Ga0207709_101193802 227
150 3300035114 Ga0373939_0000092 Ga0373939_0000092_13062_13772 227
151 3300035121 Ga0373960_0007446 Ga0373960_0007446_159_869 227
152 3300035242 Ga0373962_0007623 Ga0373962_0007623_371_1081 227
153 3300035691 Ga0373931_0000403 Ga0373931_0000403_5475_6185 227
154 3300037471 Ga0395905_0007537 Ga0395905_0007537_949_1632 227
155 3300042126 Ga0450888_000120 Ga0450888_000120_1626_2309 227
156 3300042129 Ga0450891_001515 Ga0450891_001515_1141_1824 227
157 3300042130 Ga0450892_001344 Ga0450892_001344_173_856 227
158 3300042137 Ga0450902_010007 Ga0450902_010007_173_856 227
159 3300042530 Ga0450916_011254 Ga0450916_011254_402_1085 227
160 3300042532 Ga0450893_0001121 Ga0450893_0001121_853_1536 227
161 3300042533 Ga0450901_007919 Ga0450901_007919_173_856 227
162 3300045051 Ga0451576_0040655 Ga0451576_0040655_2746_3429 227
163 3300050496 nmdc:mga07m45_2978_c1 nmdc:mga07m45_2978_c1_7118_7822 227
164 3300050496 nmdc:mga07m45_85282_c1 nmdc:mga07m45_85282_c1_182_868 227

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

71

201

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cfi-assembly4.cif.gz_D structural and functional attributes of malaria parasite ap4a hydrolase 0.8612 61 172
3cng-assembly1.cif.gz_B crystal structure of nudix hydrolase from nitrosomonas europaea 0.8547 58 171
1nqy-assembly1.cif.gz_A the structure of a coa pyrophosphatase from d. radiodurans 0.8537 60 221
5cfi-assembly3.cif.gz_C structural and functional attributes of malaria parasite ap4a hydrolase 0.8398 62 172
5qgk-assembly1.cif.gz_A pandda analysis group deposition of models with modelled events (e.g. bound ligands) -- crystal structure of nudt7 in complex with fmopl000679a 0.8307 32 226
ID Description Score Start End Superfamily
af_A0A1D8PU14_38_158_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.917 64 150 3.90.79.10
af_P43337_8_187_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8854 32 222 3.90.79.10
af_P43337_8_187_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8714 32 222 3.90.79.10
5cfiD00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8612 61 172 3.90.79.10
1nqyA00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8537 60 221 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A4R3VA18-F1-model_v4 8-oxo-dGTP pyrophosphatase MutT (NUDIX family) 0.9938 1 224 GO:0000287
GO:0009132
GO:0010945
GO:0030145
AF-W0VA56-F1-model_v4 NUDIX domain protein 0.9843 68 224 GO:0010945
AF-A0A0B8P8N1-F1-model_v4 Hypothetical nudix hydrolase yeaB 0.9831 66 174 GO:0000287
GO:0009132
GO:0010945
GO:0030145
AF-A0A537RS48-F1-model_v4 CoA pyrophosphatase 0.9792 58 222 GO:0010945
AF-A0A0N7KX06-F1-model_v4 MutT/nudix family protein 0.9771 61 222 GO:0000287
GO:0009132
GO:0010945
GO:0030145

Feature Viewer

pLDDT pTM Quality
91.07 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map