F242942

General Info

Members Datasets Scaffolds Average Seq Length
164 141 328 127

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10044632|rootH1_100446324
Length 139
Sequence LNCGRQGSPGALLPYALFMKTARVMITEKASAIVDRLSSIHGPLMFHQSGGCCDGSQPMCFPLGEFKVSEDNDVLLGEIHGCPFYMSADQYQYWKHTQLNIDVVAGRGSSFSLEIPLGLRFIIHSRLFTDAELKELGIN

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
59 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
60 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
63 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
78 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
79 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
80 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
81 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
82 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
83 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
84 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
85 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
86 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
87 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
88 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
89 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
90 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
91 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
92 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
93 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
94 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
95 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
96 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
97 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
98 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
99 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
100 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
101 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
102 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
103 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
104 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
105 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
106 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
107 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
108 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
109 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
110 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
111 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
112 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
113 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
114 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
115 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
116 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
117 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
118 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
119 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
120 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
123 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
124 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
125 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
126 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
127 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
128 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
129 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
130 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
131 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
132 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
133 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
134 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
135 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
136 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
137 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
138 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
139 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
140 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 2739367866 Hymenobacter sp. YR204 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.95
Metatranscriptomes 2.44
Isolates 0.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.1
Nodule 0
Rhizoplane 7.93
Rhizosphere 77.44
Stem 0
Stem Tuber 0
Unclassified 1.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10044632 3300003323 Bacteria 6341
2 rootH1_10052782 3300003316 Bacteria 8870
3 rootH2_10101936 3300003320 Bacteria 6175
4 rootH2_10160693 3300003320 Bacteria 3715
5 rootL2_10026356 3300003322 Bacteria 5695
6 rootL2_10142440 3300003322 Bacteria 2119
7 rootH1_10130439 3300003323 Bacteria 3953
8 JGI25160J50197_1005615 3300003354 Bacteria 5197
9 Ga0065165_1000104 3300005262 Bacteria 140410
10 Ga0065714_10070187 3300005288 Bacteria 3941
11 Ga0065704_10095887 3300005289 Bacteria 2468
12 Ga0070670_100583592 3300005331 Bacteria 999
13 Ga0070689_100071266 3300005340 Bacteria 2715
14 Ga0070671_100017930 3300005355 Bacteria 5743
15 Ga0070674_100191703 3300005356 Bacteria 1573
16 Ga0070688_100069037 3300005365 Bacteria 2255
17 Ga0070701_10148615 3300005438 Bacteria 1347
18 Ga0070700_100344046 3300005441 Bacteria 1103
19 Ga0070678_100402206 3300005456 Bacteria 1190
20 Ga0070662_100045625 3300005457 Bacteria 3146
21 Ga0070681_10946765 3300005458 Bacteria 780
22 Ga0068867_100796978 3300005459 Bacteria 842
23 Ga0068853_102014237 3300005539 Bacteria 560
24 Ga0070672_100240071 3300005543 Bacteria 1524
25 Ga0070693_101630851 3300005547 Bacteria 507
26 Ga0070665_101818186 3300005548 Bacteria 616
27 Ga0068855_100000041 3300005563 Bacteria 151653
28 Ga0068855_100586231 3300005563 Bacteria 1204
29 Ga0068856_100025906 3300005614 Bacteria 5720
30 Ga0068856_100027696 3300005614 Bacteria 5529
31 Ga0068859_100012413 3300005617 Bacteria 8572
32 Ga0068866_10671942 3300005718 Bacteria 707
33 Ga0068863_100127100 3300005841 Bacteria 2432
34 Ga0068858_100257633 3300005842 Bacteria 1658
35 Ga0097621_100950215 3300006237 Bacteria 802
36 Ga0075370_10176094 3300006353 Bacteria 1258
37 Ga0068865_100052316 3300006881 Bacteria 2830
38 Ga0097620_100012413 3300006931 Bacteria 8572
39 Ga0075435_100245448 3300007076 Bacteria 1523
40 Ga0105240_10801494 3300009093 Bacteria 1020
41 Ga0111539_10853326 3300009094 Bacteria 1060
42 Ga0105245_11759862 3300009098 Bacteria 672
43 Ga0114129_11039677 3300009147 Bacteria 1029
44 Ga0105243_12989514 3300009148 Bacteria 513
45 Ga0105241_10237966 3300009174 Bacteria 1538
46 Ga0105248_10323852 3300009177 Bacteria 1736
47 Ga0105237_10000702 3300009545 Bacteria 46425
48 Ga0105237_12407053 3300009545 Bacteria 537
49 Ga0105249_10004126 3300009553 Bacteria 12545
50 Ga0105239_10199137 3300010375 Bacteria 2243
51 Ga0105246_10042928 3300011119 Bacteria 3065
52 Ga0157371_10162983 3300013102 Bacteria 1592
53 Ga0157371_11302798 3300013102 Bacteria 562
54 Ga0157370_10090225 3300013104 Bacteria 2878
55 Ga0157370_10808363 3300013104 Bacteria 853
56 Ga0157374_10000001 3300013296 Bacteria 1077351
57 Ga0157374_10633297 3300013296 Bacteria 1081
58 Ga0157378_10047166 3300013297 Bacteria 3829
59 Ga0157378_10887138 3300013297 Bacteria 922
60 Ga0163162_10325522 3300013306 Bacteria 1669
61 Ga0157372_10272460 3300013307 Unclassified 1967
62 Ga0157375_10003433 3300013308 Bacteria 13742
63 Ga0157375_10013438 3300013308 Bacteria 7286
64 Ga0157379_10233943 3300014968 Bacteria 1666
65 Ga0157376_10005850 3300014969 Bacteria 8624
66 Ga0157376_10771670 3300014969 Bacteria 972
67 Ga0163161_10001302 3300017792 Bacteria 18594
68 Ga0206356_10019968 3300020070 Bacteria 1606
69 Ga0206356_11231009 3300020070 Bacteria 2120
70 Ga0206352_11325176 3300020078 Bacteria 1730
71 Ga0213872_10009738 3300021361 Bacteria 4596
72 Ga0209436_101213 3300025208 Bacteria 9384
73 Ga0209676_1000310 3300025292 Bacteria 95646
74 Ga0209050_1026237 3300025298 Bacteria 1957
75 Ga0207426_1000023 3300025302 Bacteria 545465
76 Ga0207642_10560255 3300025899 Bacteria 707
77 Ga0207654_10243786 3300025911 Bacteria 1202
78 Ga0207671_10028077 3300025914 Bacteria 4206
79 Ga0207644_10149327 3300025931 Bacteria 1807
80 Ga0207706_10081139 3300025933 Bacteria 2850
81 Ga0207709_11627215 3300025935 Bacteria 536
82 Ga0207667_10000404 3300025949 Bacteria 58450
83 Ga0207667_10546333 3300025949 Bacteria 1172
84 Ga0207712_10041036 3300025961 Bacteria 3178
85 Ga0207658_10570413 3300025986 Bacteria 1014
86 Ga0207702_10021866 3300026078 Bacteria 5297
87 Ga0207702_10029871 3300026078 Bacteria 4538
88 Ga0207641_10633757 3300026088 Bacteria 1049
89 Ga0268266_10266927 3300028379 Bacteria 1588
90 Ga0307517_10001574 3300028786 Bacteria 38060
91 Ga0265338_10034479 3300028800 Bacteria 4891
92 Ga0265338_10305983 3300028800 Bacteria 1154
93 Ga0265338_10400358 3300028800 Unclassified 979
94 Ga0265331_10006571 3300031250 Bacteria 6855
95 Ga0265327_10000009 3300031251 Bacteria 616360
96 Ga0265327_10000142 3300031251 Bacteria 157436
97 Ga0265327_10002289 3300031251 Bacteria 20544
98 Ga0265327_10480347 3300031251 Unclassified 536
99 Ga0307513_10802108 3300031456 Bacteria 647
100 Ga0307405_10057402 3300031731 Bacteria 2445
101 Ga0307412_10134119 3300031911 Bacteria 1804
102 Ga0307416_100758098 3300032002 Bacteria 1064
103 Ga0307414_10046409 3300032004 Bacteria 2982
104 Ga0307510_10003890 3300033180 Bacteria 17505
105 Ga0307510_10394175 3300033180 Bacteria 828
106 Ga0373929_0127552 3300035085 Bacteria 664
107 Ga0373941_0045210 3300035115 Bacteria 1377
108 Ga0373945_0113106 3300035116 Bacteria 1073
109 Ga0373943_0127447 3300035170 Bacteria 1359
110 Ga0373946_0272058 3300035171 Bacteria 831
111 Ga0373927_0118923 3300035695 Bacteria 1724
112 Ga0373947_0042123 3300035725 Bacteria 2725
113 Ga0436361_0684828 3300039447 Bacteria 21305
114 Ga0495603_0058506 3300046455 Bacteria 2279
115 Ga0495629_0003052 3300046459 Bacteria 12730
116 Ga0495641_0058307 3300046461 Bacteria 1747
117 Ga0495580_0003219 3300046472 Bacteria 13966
118 Ga0495582_0000431 3300046473 Bacteria 22867
119 Ga0495639_0063856 3300046475 Bacteria 1691
120 Ga0495594_0001827 3300046499 Bacteria 11079
121 Ga0495596_0153208 3300046500 Bacteria 895
122 Ga0495631_0028794 3300046518 Bacteria 2532
123 Ga0495632_0071819 3300046519 Bacteria 1662
124 Ga0495666_0055798 3300046526 Bacteria 1893
125 Ga0495665_0183321 3300046531 Bacteria 1087
126 Ga0495622_0001588 3300046557 Bacteria 11233
127 Ga0495634_0198358 3300046642 Bacteria 1248
128 Ga0495647_0001383 3300046681 Bacteria 7478
129 Ga0495658_0001984 3300046683 Bacteria 10424
130 Ga0495669_0469853 3300046684 Bacteria 611
131 Ga0495613_0009862 3300046689 Bacteria 7102
132 Ga0495670_0476541 3300046691 Bacteria 677
133 Ga0495581_0353012 3300047315 Bacteria 858
134 Ga0495676_0140125 3300047321 Bacteria 1734
135 Ga0495683_0010899 3300047323 Bacteria 4794
136 Ga0495687_002127 3300047443 Bacteria 16569
137 Ga0495686_0000066 3300047472 Bacteria 225023
138 Ga0495593_0006338 3300047673 Bacteria 6942
139 Ga0495614_0028070 3300048089 Bacteria 2426
140 Ga0496100_0150233 3300048903 Bacteria 1660
141 Ga0496101_0053153 3300048904 Bacteria 2921
142 Ga0496102_0081555 3300048905 Bacteria 2982
143 Ga0496103_0145249 3300048906 Bacteria 1518
144 Ga0496104_0435747 3300048907 Bacteria 1222
145 Ga0496105_0030417 3300048908 Bacteria 4424
146 Ga0496106_0045208 3300048909 Bacteria 3307
147 Ga0496107_0009796 3300048910 Bacteria 6645
148 Ga0496108_0076845 3300048911 Bacteria 2823
149 Ga0496108_0164354 3300048911 Bacteria 1919
150 Ga0496109_0531620 3300048912 Bacteria 1109
151 Ga0496110_0474391 3300048913 Bacteria 1140
152 Ga0496115_0026481 3300048918 Bacteria 4526
153 Ga0496124_0275332 3300048927 Bacteria 1230
154 Ga0496126_0586521 3300048929 Bacteria 880
155 Ga0501219_000060 3300049703 Bacteria 17817
156 Ga0501241_008585 3300049758 Bacteria 1865
157 Ga0501284_00088 3300050005 Bacteria 22558
158 Ga0495619_0134541 3300053085 Bacteria 1700
159 Ga0495619_0183836 3300053085 Bacteria 1446
160 Ga0500646_0195868 3300053090 Bacteria 691
161 Ga0500588_0130666 3300053146 Bacteria 894
162 Ga0500637_0030631 3300053178 Bacteria 2996
163 Ga0587111_0004164 3300060346 Bacteria 2130
164 2740034362 2739367866 Bacteria 4215900
165 rootH1_10044632
166 rootH1_10052782
167 rootH2_10101936
168 rootH2_10160693
169 rootL2_10026356
170 rootL2_10142440
171 rootH1_10130439
172 JGI25160J50197_1005615
173 Ga0065165_1000104
174 Ga0065714_10070187
175 Ga0065704_10095887
176 Ga0070670_100583592
177 Ga0070689_100071266
178 Ga0070671_100017930
179 Ga0070674_100191703
180 Ga0070688_100069037
181 Ga0070701_10148615
182 Ga0070700_100344046
183 Ga0070678_100402206
184 Ga0070662_100045625
185 Ga0070681_10946765
186 Ga0068867_100796978
187 Ga0068853_102014237
188 Ga0070672_100240071
189 Ga0070693_101630851
190 Ga0070665_101818186
191 Ga0068855_100000041
192 Ga0068855_100586231
193 Ga0068856_100025906
194 Ga0068856_100027696
195 Ga0068859_100012413
196 Ga0068866_10671942
197 Ga0068863_100127100
198 Ga0068858_100257633
199 Ga0097621_100950215
200 Ga0075370_10176094
201 Ga0068865_100052316
202 Ga0097620_100012413
203 Ga0075435_100245448
204 Ga0105240_10801494
205 Ga0111539_10853326
206 Ga0105245_11759862
207 Ga0114129_11039677
208 Ga0105243_12989514
209 Ga0105241_10237966
210 Ga0105248_10323852
211 Ga0105237_10000702
212 Ga0105237_12407053
213 Ga0105249_10004126
214 Ga0105239_10199137
215 Ga0105246_10042928
216 Ga0157371_10162983
217 Ga0157371_11302798
218 Ga0157370_10090225
219 Ga0157370_10808363
220 Ga0157374_10000001
221 Ga0157374_10633297
222 Ga0157378_10047166
223 Ga0157378_10887138
224 Ga0163162_10325522
225 Ga0157372_10272460
226 Ga0157375_10003433
227 Ga0157375_10013438
228 Ga0157379_10233943
229 Ga0157376_10005850
230 Ga0157376_10771670
231 Ga0163161_10001302
232 Ga0206356_10019968
233 Ga0206356_11231009
234 Ga0206352_11325176
235 Ga0213872_10009738
236 Ga0209436_101213
237 Ga0209676_1000310
238 Ga0209050_1026237
239 Ga0207426_1000023
240 Ga0207642_10560255
241 Ga0207654_10243786
242 Ga0207671_10028077
243 Ga0207644_10149327
244 Ga0207706_10081139
245 Ga0207709_11627215
246 Ga0207667_10000404
247 Ga0207667_10546333
248 Ga0207712_10041036
249 Ga0207658_10570413
250 Ga0207702_10021866
251 Ga0207702_10029871
252 Ga0207641_10633757
253 Ga0268266_10266927
254 Ga0307517_10001574
255 Ga0265338_10034479
256 Ga0265338_10305983
257 Ga0265338_10400358
258 Ga0265331_10006571
259 Ga0265327_10000009
260 Ga0265327_10000142
261 Ga0265327_10002289
262 Ga0265327_10480347
263 Ga0307513_10802108
264 Ga0307405_10057402
265 Ga0307412_10134119
266 Ga0307416_100758098
267 Ga0307414_10046409
268 Ga0307510_10003890
269 Ga0307510_10394175
270 Ga0373929_0127552
271 Ga0373941_0045210
272 Ga0373945_0113106
273 Ga0373943_0127447
274 Ga0373946_0272058
275 Ga0373927_0118923
276 Ga0373947_0042123
277 Ga0436361_0684828
278 Ga0495603_0058506
279 Ga0495629_0003052
280 Ga0495641_0058307
281 Ga0495580_0003219
282 Ga0495582_0000431
283 Ga0495639_0063856
284 Ga0495594_0001827
285 Ga0495596_0153208
286 Ga0495631_0028794
287 Ga0495632_0071819
288 Ga0495666_0055798
289 Ga0495665_0183321
290 Ga0495622_0001588
291 Ga0495634_0198358
292 Ga0495647_0001383
293 Ga0495658_0001984
294 Ga0495669_0469853
295 Ga0495613_0009862
296 Ga0495670_0476541
297 Ga0495581_0353012
298 Ga0495676_0140125
299 Ga0495683_0010899
300 Ga0495687_002127
301 Ga0495686_0000066
302 Ga0495593_0006338
303 Ga0495614_0028070
304 Ga0496100_0150233
305 Ga0496101_0053153
306 Ga0496102_0081555
307 Ga0496103_0145249
308 Ga0496104_0435747
309 Ga0496105_0030417
310 Ga0496106_0045208
311 Ga0496107_0009796
312 Ga0496108_0076845
313 Ga0496108_0164354
314 Ga0496109_0531620
315 Ga0496110_0474391
316 Ga0496115_0026481
317 Ga0496124_0275332
318 Ga0496126_0586521
319 Ga0501219_000060
320 Ga0501241_008585
321 Ga0501284_00088
322 Ga0495619_0134541
323 Ga0495619_0183836
324 Ga0500646_0195868
325 Ga0500588_0130666
326 Ga0500637_0030631
327 Ga0587111_0004164
328 2740034362

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05610

DUF779

Protein of unknown function (DUF779)

33

127

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nwb-assembly1.cif.gz_A solution nmr structure of protein aq_1857 from aquifex aeolicus: northeast structural genomics consortium target qr6. 0.631 18 121
1nwb-assembly1.cif.gz_A solution nmr structure of protein aq_1857 from aquifex aeolicus: northeast structural genomics consortium target qr6. 0.5933 18 121
1s98-assembly1.cif.gz_A e.coli isca crystal structure to 2.3 a 0.5907 22 127
1x0g-assembly1.cif.gz_A crystal structure of isca with the [2fe-2s] cluster 0.581 22 124
1s98-assembly1.cif.gz_A e.coli isca crystal structure to 2.3 a 0.5764 22 127
ID Description Score Start End Superfamily
af_O53744_16_113_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.9164 32 124 2.60.300.12
af_O53744_16_113_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8625 32 124 2.60.300.12
af_O96161_49_160_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.6438 22 124 2.60.300.12
af_Q8I3N6_67_177_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.6363 22 101 2.60.300.12
af_D4A4L5_49_154_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.6333 22 101 2.60.300.12
ID Description Score Start End GO Terms
AF-A0A5B8V3M0-F1-model_v4 DUF779 domain-containing protein 0.9758 17 149
AF-A0A562UG85-F1-model_v4 DUF779 domain-containing protein 0.975 17 146
AF-A0A2V5D372-F1-model_v4 deleted 0.9736 59 131
AF-E4TTN5-F1-model_v4 UDP-glucose 4-epimerase 0.9732 19 146
AF-V4JJK9-F1-model_v4 DUF779 domain-containing protein 0.9726 17 132

Map