F242733

General Info

Members Datasets Scaffolds Average Seq Length
163 120 326 179

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2744054611|2744957738
Length 207
Sequence GEPGPVRGVGLYVSVQRTESGKFGCYVQTMSAPRIEPGRLRELGPINWVLWRALSLGAGAPDAHLFSTLGRAGGLFRGWLHYSGKLMPGGRLPRHESELVILRVAHLRDCGYEMDHHIRLGRRAGVTPEILDRVRTGPEAEGWSPKHRALLTAVDQLVATKDVDDAAWAELGKHYDERRLIEVVLLTTQYDGLATTIGTLRVARDFE

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
14 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
16 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
17 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
18 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
19 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
20 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
21 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
22 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
23 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
24 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
25 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
26 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
27 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
28 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
29 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
39 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
40 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
41 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
42 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
43 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
44 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
45 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
46 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
47 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
48 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
49 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
50 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
51 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
52 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
53 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
54 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
55 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
56 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
57 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
58 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
59 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
60 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
61 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
62 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
63 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
64 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
65 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
66 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
67 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
68 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
69 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
70 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
71 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
72 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
73 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
74 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
78 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
79 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
80 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
81 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
82 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
83 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
84 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
85 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
86 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
88 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
89 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
90 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
91 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
92 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
93 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
94 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
95 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
96 2547132424 Nocardia nova SH22a Isolate Unclassified
97 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
98 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
99 2643221561 Nocardioides sp. Root151 Isolate Unclassified
100 2643221576 Nocardioides sp. Root614 Isolate Unclassified
101 2643221590 Nocardioides sp. Root682 Isolate Unclassified
102 2643221604 Nocardioides sp. Root190 Isolate Unclassified
103 2643221617 Nocardioides sp. Root79 Isolate Unclassified
104 2643221620 Nocardioides sp. Root240 Isolate Unclassified
105 2643221692 Nocardia sp. Root136 Isolate Unclassified
106 2643221696 Nocardioides sp. Root140 Isolate Unclassified
107 2738541305 Nocardioides sp. CF167 Isolate Unclassified
108 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
109 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
110 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
111 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
112 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
113 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
114 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
115 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
116 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
117 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
118 2922554459 Rhodococcus sp. 66b Isolate Unclassified
119 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
120 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 82.21
Metatranscriptomes 1.84
Isolates 15.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.36
Nodule 0
Rhizoplane 3.07
Rhizosphere 73.62
Stem 0
Stem Tuber 0
Unclassified 3.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10109508 3300003322 Bacteria 1503
2 Ga0006562J51391_1114118 3300003578 Bacteria 1180
3 Ga0070658_10060786 3300005327 Bacteria 3077
4 Ga0070683_100455832 3300005329 Bacteria 1220
5 Ga0070660_100099596 3300005339 Bacteria 2301
6 Ga0070674_100360279 3300005356 Bacteria 1177
7 Ga0070659_100089884 3300005366 Bacteria 2460
8 Ga0070659_101011520 3300005366 Bacteria 730
9 Ga0070714_100172190 3300005435 Bacteria 1965
10 Ga0070684_100994067 3300005535 Bacteria 787
11 Ga0070665_100457550 3300005548 Bacteria 1286
12 Ga0068855_100641249 3300005563 Unclassified 1142
13 Ga0068856_100170101 3300005614 Bacteria 2191
14 Ga0068856_100634347 3300005614 Bacteria 1089
15 Ga0068852_100006910 3300005616 Bacteria 8253
16 Ga0068852_101032781 3300005616 Bacteria 841
17 Ga0081455_10000520 3300005937 Bacteria 49994
18 Ga0075363_100136276 3300006048 Bacteria 1380
19 Ga0075363_100283928 3300006048 Bacteria 958
20 Ga0075364_10094798 3300006051 Bacteria 1983
21 Ga0075364_10268284 3300006051 Bacteria 1161
22 Ga0075367_10240346 3300006178 Bacteria 1135
23 Ga0075370_10042805 3300006353 Bacteria 2558
24 Ga0075370_10278168 3300006353 Bacteria 994
25 Ga0068865_100883561 3300006881 Bacteria 776
26 Ga0105240_10341820 3300009093 Bacteria 1700
27 Ga0105243_10358384 3300009148 Bacteria 1341
28 Ga0105239_10797568 3300010375 Bacteria 1082
29 Ga0105246_10085901 3300011119 Bacteria 2254
30 Ga0157369_10884138 3300013105 Bacteria 917
31 Ga0163163_10447839 3300014325 Bacteria 1351
32 Ga0206354_11448742 3300020081 Bacteria 1885
33 Ga0206353_10896397 3300020082 Bacteria 1946
34 Ga0213875_10006261 3300021388 Bacteria 6264
35 Ga0207647_10025334 3300025904 Bacteria 3900
36 Ga0207647_10186925 3300025904 Bacteria 1201
37 Ga0207657_10003212 3300025919 Bacteria 17497
38 Ga0207687_10038867 3300025927 Bacteria 3254
39 Ga0207664_10255496 3300025929 Bacteria 1531
40 Ga0207667_10459636 3300025949 Unclassified 1293
41 Ga0207667_10701415 3300025949 Bacteria 1014
42 Ga0207712_10073888 3300025961 Bacteria 2460
43 Ga0207702_10482576 3300026078 Bacteria 1206
44 Ga0207702_10997654 3300026078 Bacteria 831
45 Ga0207698_10004503 3300026142 Bacteria 8502
46 Ga0207698_10548181 3300026142 Bacteria 1133
47 Ga0268266_10407752 3300028379 Bacteria 1286
48 Ga0316182_1047709 3300030745 Bacteria 2400
49 Ga0307409_100268934 3300031995 Bacteria 1569
50 Ga0395899_0024817 3300037312 Bacteria 4530
51 Ga0395900_0006075 3300037418 Bacteria 12597
52 Ga0395898_1188429 3300037466 Unclassified 694
53 Ga0436364_0125936 3300037853 Bacteria 13594
54 Ga0436364_1185000 3300037853 Bacteria 967
55 Ga0395901_0271127 3300038443 Bacteria 1765
56 Ga0439465_0052582 3300041413 Bacteria 1337
57 Ga0439465_0243480 3300041413 Bacteria 664
58 Ga0451853_2916024 3300041512 Bacteria 1547
59 Ga0439445_0006355 3300042004 Bacteria 2713
60 Ga0439434_0168390 3300042435 Bacteria 730
61 Ga0466969_0171470 3300044656 Bacteria 995
62 Ga0466972_0172275 3300044658 Unclassified 1016
63 Ga0466965_0099198 3300044683 Bacteria 1488
64 Ga0466965_0213365 3300044683 Bacteria 1027
65 Ga0466966_0086309 3300044684 Bacteria 1951
66 Ga0466966_0168964 3300044684 Bacteria 1330
67 Ga0466966_0192426 3300044684 Unclassified 1236
68 Ga0466966_0451406 3300044684 Bacteria 773
69 Ga0466961_0004211 3300044693 Bacteria 9000
70 Ga0466961_0128595 3300044693 Bacteria 1588
71 Ga0466963_0017417 3300044694 Bacteria 4479
72 Ga0466963_0039104 3300044694 Bacteria 3106
73 Ga0466971_0002674 3300044719 Bacteria 7527
74 Ga0466971_0064668 3300044719 Bacteria 1656
75 Ga0466971_0108139 3300044719 Bacteria 1282
76 Ga0466971_0255047 3300044719 Bacteria 836
77 Ga0466971_0353479 3300044719 Bacteria 711
78 Ga0466968_0304766 3300044735 Bacteria 767
79 Ga0466970_0012238 3300044765 Bacteria 4383
80 Ga0466970_0189660 3300044765 Bacteria 1142
81 Ga0466957_0014837 3300044842 Bacteria 4542
82 Ga0466957_0037683 3300044842 Bacteria 2911
83 Ga0466960_0152133 3300044901 Bacteria 1237
84 Ga0466959_0009431 3300045049 Bacteria 6941
85 Ga0466958_0003684 3300045836 Bacteria 7999
86 Ga0466958_0060745 3300045836 Bacteria 2301
87 Ga0466958_0069502 3300045836 Bacteria 2153
88 Ga0466958_0269466 3300045836 Bacteria 1090
89 Ga0466967_0003715 3300045976 Bacteria 10055
90 Ga0466967_0018860 3300045976 Bacteria 5531
91 Ga0466967_0025067 3300045976 Bacteria 4912
92 Ga0466967_0057696 3300045976 Bacteria 3428
93 Ga0466967_0088976 3300045976 Bacteria 2803
94 Ga0466967_0143104 3300045976 Bacteria 2229
95 Ga0466967_0170542 3300045976 Bacteria 2047
96 Ga0466967_0300665 3300045976 Bacteria 1544
97 Ga0466967_0632035 3300045976 Bacteria 1058
98 Ga0466967_1090996 3300045976 Bacteria 795
99 Ga0495580_0067818 3300046472 Bacteria 2496
100 Ga0495630_0718235 3300046517 Bacteria 764
101 Ga0495665_0036660 3300046531 Bacteria 2618
102 Ga0495581_0198514 3300047315 Bacteria 1173
103 Ga0495683_0000421 3300047323 Bacteria 33926
104 Ga0495593_0121056 3300047673 Bacteria 1332
105 Ga0496108_0199234 3300048911 Bacteria 1737
106 Ga0496110_0021945 3300048913 Bacteria 5415
107 Ga0496110_0096224 3300048913 Bacteria 2653
108 Ga0496114_0096504 3300048917 Bacteria 2517
109 Ga0496114_0148896 3300048917 Bacteria 2030
110 Ga0496125_0082915 3300048928 Bacteria 2441
111 Ga0496126_0171705 3300048929 Bacteria 1847
112 Ga0501034_0049696 3300049571 Bacteria 4231
113 Ga0501037_0434018 3300049573 Bacteria 898
114 Ga0501038_0033074 3300049574 Bacteria 4556
115 Ga0501038_0054757 3300049574 Bacteria 3430
116 Ga0501047_0058096 3300049581 Bacteria 3738
117 Ga0501070_0000718 3300049586 Bacteria 30268
118 Ga0501071_0013435 3300049587 Bacteria 5580
119 Ga0501073_0001910 3300049589 Bacteria 15525
120 Ga0501074_0063753 3300049590 Bacteria 2654
121 Ga0501074_0180836 3300049590 Bacteria 1504
122 Ga0501077_0683411 3300049593 Bacteria 659
123 Ga0501079_0008788 3300049741 Bacteria 7654
124 Ga0501080_0017285 3300049742 Bacteria 6666
125 Ga0501083_0001043 3300049744 Bacteria 18468
126 Ga0501035_0620763 3300049822 Bacteria 879
127 Ga0501044_0001673 3300049823 Bacteria 26047
128 nmdc:mga03n38_21059_c1 3300050490 Bacteria 2618
129 nmdc:mga03n38_328986_c1 3300050490 Bacteria 827
130 nmdc:mga00v17_251121_c1 3300050491 Bacteria 1147
131 Ga0500635_0040094 3300053080 Bacteria 1561
132 Ga0500652_000192 3300053131 Bacteria 23637
133 Ga0501084_0000584 3300054114 Bacteria 27883
134 Ga0501082_0311766 3300060353 Bacteria 1370
135 Ga0466962_0007414 3300061719 Bacteria 5264
136 Ga0466962_0040474 3300061719 Bacteria 2231
137 Ga0466962_0077110 3300061719 Bacteria 1593
138 2744957738 2744054611 Bacteria 5611514
139 2548699380 2547132424 Bacteria 8348532
140 2552111193 2551306166 Bacteria 9731570
141 2566996861 2565956761 Bacteria 6601618
142 2643825748 2643221561 Bacteria 4984412
143 2643888831 2643221576 Bacteria 5214352
144 2643957886 2643221590 Bacteria 5214697
145 2644034394 2643221604 Bacteria 5014917
146 2644098560 2643221617 Bacteria 5139111
147 2644114581 2643221620 Bacteria 5134593
148 2644514252 2643221692 Bacteria 7282860
149 2644531740 2643221696 Bacteria 5431823
150 2738869830 2738541305 Bacteria 4910150
151 2738887769 2738541308 Bacteria 7020677
152 2739202519 2738543005 Bacteria 5278128
153 2739366440 2738543034 Bacteria 6084756
154 2812332532 2811994874 Bacteria 5367947
155 2904541368 2904535858 Bacteria 6308016
156 2904767683 2904765812 Bacteria 5369154
157 2904774540 2904770941 Bacteria 5580202
158 2919424669 2919420072 Bacteria 5390363
159 2919436950 2919432681 Bacteria 5390474
160 2919720066 2919713450 Bacteria 7431245
161 2922560254 2922554459 Bacteria 6683962
162 2928143266 2928142448 Bacteria 5288925
163 3003000768 3002998708 Bacteria 11715108
164 rootL2_10109508
165 Ga0006562J51391_1114118
166 Ga0070658_10060786
167 Ga0070683_100455832
168 Ga0070660_100099596
169 Ga0070674_100360279
170 Ga0070659_100089884
171 Ga0070659_101011520
172 Ga0070714_100172190
173 Ga0070684_100994067
174 Ga0070665_100457550
175 Ga0068855_100641249
176 Ga0068856_100170101
177 Ga0068856_100634347
178 Ga0068852_100006910
179 Ga0068852_101032781
180 Ga0081455_10000520
181 Ga0075363_100136276
182 Ga0075363_100283928
183 Ga0075364_10094798
184 Ga0075364_10268284
185 Ga0075367_10240346
186 Ga0075370_10042805
187 Ga0075370_10278168
188 Ga0068865_100883561
189 Ga0105240_10341820
190 Ga0105243_10358384
191 Ga0105239_10797568
192 Ga0105246_10085901
193 Ga0157369_10884138
194 Ga0163163_10447839
195 Ga0206354_11448742
196 Ga0206353_10896397
197 Ga0213875_10006261
198 Ga0207647_10025334
199 Ga0207647_10186925
200 Ga0207657_10003212
201 Ga0207687_10038867
202 Ga0207664_10255496
203 Ga0207667_10459636
204 Ga0207667_10701415
205 Ga0207712_10073888
206 Ga0207702_10482576
207 Ga0207702_10997654
208 Ga0207698_10004503
209 Ga0207698_10548181
210 Ga0268266_10407752
211 Ga0316182_1047709
212 Ga0307409_100268934
213 Ga0395899_0024817
214 Ga0395900_0006075
215 Ga0395898_1188429
216 Ga0436364_0125936
217 Ga0436364_1185000
218 Ga0395901_0271127
219 Ga0439465_0052582
220 Ga0439465_0243480
221 Ga0451853_2916024
222 Ga0439445_0006355
223 Ga0439434_0168390
224 Ga0466969_0171470
225 Ga0466972_0172275
226 Ga0466965_0099198
227 Ga0466965_0213365
228 Ga0466966_0086309
229 Ga0466966_0168964
230 Ga0466966_0192426
231 Ga0466966_0451406
232 Ga0466961_0004211
233 Ga0466961_0128595
234 Ga0466963_0017417
235 Ga0466963_0039104
236 Ga0466971_0002674
237 Ga0466971_0064668
238 Ga0466971_0108139
239 Ga0466971_0255047
240 Ga0466971_0353479
241 Ga0466968_0304766
242 Ga0466970_0012238
243 Ga0466970_0189660
244 Ga0466957_0014837
245 Ga0466957_0037683
246 Ga0466960_0152133
247 Ga0466959_0009431
248 Ga0466958_0003684
249 Ga0466958_0060745
250 Ga0466958_0069502
251 Ga0466958_0269466
252 Ga0466967_0003715
253 Ga0466967_0018860
254 Ga0466967_0025067
255 Ga0466967_0057696
256 Ga0466967_0088976
257 Ga0466967_0143104
258 Ga0466967_0170542
259 Ga0466967_0300665
260 Ga0466967_0632035
261 Ga0466967_1090996
262 Ga0495580_0067818
263 Ga0495630_0718235
264 Ga0495665_0036660
265 Ga0495581_0198514
266 Ga0495683_0000421
267 Ga0495593_0121056
268 Ga0496108_0199234
269 Ga0496110_0021945
270 Ga0496110_0096224
271 Ga0496114_0096504
272 Ga0496114_0148896
273 Ga0496125_0082915
274 Ga0496126_0171705
275 Ga0501034_0049696
276 Ga0501037_0434018
277 Ga0501038_0033074
278 Ga0501038_0054757
279 Ga0501047_0058096
280 Ga0501070_0000718
281 Ga0501071_0013435
282 Ga0501073_0001910
283 Ga0501074_0063753
284 Ga0501074_0180836
285 Ga0501077_0683411
286 Ga0501079_0008788
287 Ga0501080_0017285
288 Ga0501083_0001043
289 Ga0501035_0620763
290 Ga0501044_0001673
291 nmdc:mga03n38_21059_c1
292 nmdc:mga03n38_328986_c1
293 nmdc:mga00v17_251121_c1
294 Ga0500635_0040094
295 Ga0500652_000192
296 Ga0501084_0000584
297 Ga0501082_0311766
298 Ga0466962_0007414
299 Ga0466962_0040474
300 Ga0466962_0077110
301 2744957738
302 2548699380
303 2552111193
304 2566996861
305 2643825748
306 2643888831
307 2643957886
308 2644034394
309 2644098560
310 2644114581
311 2644514252
312 2644531740
313 2738869830
314 2738887769
315 2739202519
316 2739366440
317 2812332532
318 2904541368
319 2904767683
320 2904774540
321 2919424669
322 2919436950
323 2919720066
324 2922560254
325 2928143266
326 3003000768

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

73

156

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.912 44 173
2ijc-assembly2.cif.gz_I structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa 0.8997 40 175
6k40-assembly5.cif.gz_K crystal structure of alkyl hydroperoxide reductase from d. radiodurans r1 0.8988 1 175
2gmy-assembly1.cif.gz_C crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd 0.8924 46 177
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.8864 44 173
ID Description Score Start End Superfamily
af_O53905_23_180_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.947 36 175 1.20.1290.10
af_O53749_49_187_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9262 45 176 1.20.1290.10
af_O53377_388_550_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9076 20 175 1.20.1290.10
2oyoB02 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8934 63 175 1.20.1290.10
af_Q2FVE0_2_139_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8886 40 170 1.20.1290.10
ID Description Score Start End GO Terms
AF-H0E7Q6-F1-model_v4 Carboxymuconolactone decarboxylase-like domain-containing protein 0.9932 2 179 GO:0051920
AF-A0A5B2W312-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9906 49 179 GO:0051920
AF-A0A6J6RRN2-F1-model_v4 Unannotated protein 0.9899 3 179 GO:0051920
AF-A0A8A5YQC8-F1-model_v4 deleted 0.9895 2 178
AF-A0A7V8NFV2-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9892 1 178 GO:0051920

Map