F242693

General Info

Members Datasets Scaffolds Average Seq Length
163 131 163 114

Family's Representative Sequence

Representative Sequence 3300059426|Ga0590077_001139|Ga0590077_001139_1302_1715
Length 137
Sequence MRKPELRSFPGAGKLEADMPKYMLLLHDNPSVFTSMSPEEMQKALEKYMAWGNKLRTSGILLASDKLTDEPGRVMRGKNGQVRVTDGPYSETKEVLGGYYAIEAASYDEAMDRARDCPHLAYGGTIEVRQIDDMLGQ

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
59 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
85 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
88 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
89 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
90 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
91 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
95 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
96 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
97 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
98 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
99 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
100 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
101 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
102 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
103 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
104 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
105 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
106 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
107 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
108 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
109 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
110 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
111 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
112 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
116 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
117 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
118 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
119 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
120 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
121 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
122 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
123 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
124 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
125 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
126 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
127 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
128 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
129 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
130 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
131 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.29
Nodule 0
Rhizoplane 1.23
Rhizosphere 92.64
Stem 0
Stem Tuber 0
Unclassified 1.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_10932331 2162886012 Bacteria 1091
2 Ga0065715_10316580 3300005293 Bacteria 1010
3 Ga0070666_10954256 3300005335 Bacteria 635
4 Ga0070661_101393861 3300005344 Bacteria 589
5 Ga0070668_101287461 3300005347 Bacteria 664
6 Ga0070671_100851379 3300005355 Bacteria 795
7 Ga0070671_101834403 3300005355 Unclassified 539
8 Ga0070659_100338914 3300005366 Bacteria 1259
9 Ga0070667_100413139 3300005367 Bacteria 1229
10 Ga0070709_10126666 3300005434 Bacteria 1738
11 Ga0070709_10187096 3300005434 Unclassified 1458
12 Ga0070709_10608259 3300005434 Bacteria 842
13 Ga0070713_101008001 3300005436 Bacteria 803
14 Ga0070713_102313176 3300005436 Unclassified 520
15 Ga0070711_100588378 3300005439 Bacteria 927
16 Ga0070708_100774241 3300005445 Unclassified 902
17 Ga0070678_101613613 3300005456 Unclassified 609
18 Ga0070681_10090529 3300005458 Unclassified 3010
19 Ga0070706_100178566 3300005467 Bacteria 1982
20 Ga0070707_100894897 3300005468 Unclassified 852
21 Ga0068853_100148810 3300005539 Bacteria 2106
22 Ga0070695_101005897 3300005545 Unclassified 678
23 Ga0070665_100442459 3300005548 Bacteria 1309
24 Ga0068855_100057683 3300005563 Bacteria 4551
25 Ga0070664_100712660 3300005564 Bacteria 935
26 Ga0068856_100781676 3300005614 Bacteria 974
27 Ga0068852_102829605 3300005616 Bacteria 503
28 Ga0068859_100978831 3300005617 Bacteria 929
29 Ga0068861_100471867 3300005719 Bacteria 1129
30 Ga0068858_101257890 3300005842 Bacteria 728
31 Ga0068860_100418010 3300005843 Bacteria 1329
32 Ga0068860_102319957 3300005843 Unclassified 557
33 Ga0081455_10010867 3300005937 Bacteria 9188
34 Ga0075368_10009645 3300006042 Bacteria 3476
35 Ga0075363_100598079 3300006048 Bacteria 661
36 Ga0070716_100338370 3300006173 Bacteria 1061
37 Ga0070712_101326446 3300006175 Bacteria 627
38 Ga0075367_10004920 3300006178 Bacteria 6582
39 Ga0075428_102753539 3300006844 Unclassified 500
40 Ga0075430_100347874 3300006846 Bacteria 1224
41 Ga0075430_101117621 3300006846 Bacteria 649
42 Ga0075431_100004019 3300006847 Bacteria 14332
43 Ga0075431_100148097 3300006847 Unclassified 2418
44 Ga0075431_100784027 3300006847 Bacteria 927
45 Ga0075436_100005938 3300006914 Bacteria 8388
46 Ga0075436_100301426 3300006914 Bacteria 1149
47 Ga0097620_100978814 3300006931 Bacteria 929
48 Ga0105240_10020287 3300009093 Bacteria 8871
49 Ga0111539_10225339 3300009094 Bacteria 2183
50 Ga0111539_10777909 3300009094 Bacteria 1114
51 Ga0105247_10166573 3300009101 Bacteria 1463
52 Ga0105241_10793970 3300009174 Bacteria 871
53 Ga0105248_10000003 3300009177 Bacteria 1019601
54 Ga0105248_10021094 3300009177 Bacteria 7219
55 Ga0105248_10077533 3300009177 Bacteria 3736
56 Ga0105237_11524526 3300009545 Archaea 675
57 Ga0105238_12216011 3300009551 Bacteria 584
58 Ga0105249_11974121 3300009553 Unclassified 656
59 Ga0157371_10815463 3300013102 Bacteria 704
60 Ga0157370_10584766 3300013104 Bacteria 1023
61 Ga0157369_10016752 3300013105 Bacteria 8237
62 Ga0157374_10037649 3300013296 Bacteria 4442
63 Ga0157378_11094341 3300013297 Bacteria 834
64 Ga0157372_10681906 3300013307 Bacteria 1196
65 Ga0157375_10700842 3300013308 Bacteria 1166
66 Ga0163163_10160998 3300014325 Bacteria 2290
67 Ga0163163_10225353 3300014325 Bacteria 1923
68 Ga0157380_10117480 3300014326 Bacteria 2246
69 Ga0157379_10032057 3300014968 Bacteria 4683
70 Ga0157379_10494515 3300014968 Bacteria 1133
71 Ga0157379_10510657 3300014968 Bacteria 1115
72 Ga0157376_10050688 3300014969 Unclassified 3445
73 Ga0157376_11644255 3300014969 Bacteria 677
74 Ga0213875_10232860 3300021388 Unclassified 868
75 Ga0207710_10134991 3300025900 Bacteria 1187
76 Ga0207680_10433369 3300025903 Bacteria 932
77 Ga0207707_10179247 3300025912 Unclassified 1850
78 Ga0207695_10110332 3300025913 Bacteria 2731
79 Ga0207671_10889370 3300025914 Archaea 704
80 Ga0207663_10400950 3300025916 Bacteria 1049
81 Ga0207662_11370129 3300025918 Unclassified 502
82 Ga0207649_10096377 3300025920 Bacteria 1949
83 Ga0207700_11632211 3300025928 Bacteria 570
84 Ga0207669_11264144 3300025937 Bacteria 626
85 Ga0207665_10640161 3300025939 Bacteria 833
86 Ga0207711_10000013 3300025941 Bacteria 514850
87 Ga0207711_10027903 3300025941 Bacteria 4746
88 Ga0207679_10634688 3300025945 Bacteria 965
89 Ga0207667_10085537 3300025949 Bacteria 3264
90 Ga0207712_11270790 3300025961 Unclassified 657
91 Ga0207668_10743210 3300025972 Unclassified 865
92 Ga0207658_10703458 3300025986 Bacteria 913
93 Ga0207703_10368575 3300026035 Bacteria 1326
94 Ga0207703_10529565 3300026035 Unclassified 1109
95 Ga0207639_10000013 3300026041 Bacteria 293084
96 Ga0207639_10005281 3300026041 Bacteria 8719
97 Ga0207675_100077564 3300026118 Bacteria 3113
98 Ga0207698_12254753 3300026142 Bacteria 557
99 Ga0209974_10040047 3300027876 Unclassified 1559
100 Ga0207428_10202988 3300027907 Bacteria 1491
101 Ga0268266_10322649 3300028379 Bacteria 1446
102 Ga0268266_12190604 3300028379 Bacteria 525
103 Ga0268264_10358129 3300028381 Bacteria 1391
104 Ga0268264_12073006 3300028381 Bacteria 577
105 Ga0307405_11547088 3300031731 Unclassified 584
106 Ga0307413_10830695 3300031824 Bacteria 779
107 Ga0307409_101901445 3300031995 Bacteria 625
108 Ga0373941_0172901 3300035115 Bacteria 806
109 Ga0373945_0297898 3300035116 Bacteria 690
110 Ga0373956_0315321 3300035119 Bacteria 745
111 Ga0373935_0409622 3300035692 Unclassified 975
112 Ga0373927_0184251 3300035695 Bacteria 1370
113 Ga0373927_0410381 3300035695 Bacteria 894
114 Ga0373937_1493023 3300036401 Bacteria 623
115 Ga0373937_1870539 3300036401 Bacteria 546
116 Ga0373925_0167420 3300037068 Bacteria 1734
117 Ga0436364_0818921 3300037853 Unclassified 1110
118 Ga0436364_1081482 3300037853 Unclassified 604
119 Ga0450896_032211 3300042133 Bacteria 797
120 Ga0439435_0045656 3300042436 Bacteria 1239
121 Ga0439464_0054909 3300042439 Bacteria 1158
122 Ga0439464_0067386 3300042439 Bacteria 1055
123 Ga0439460_0179604 3300042461 Bacteria 715
124 Ga0450916_022902 3300042530 Bacteria 869
125 Ga0439440_0233706 3300042993 Bacteria 555
126 Ga0451576_0734722 3300045051 Bacteria 1037
127 Ga0495580_0015629 3300046472 Bacteria 5719
128 Ga0495580_0473217 3300046472 Unclassified 839
129 Ga0495666_0460771 3300046526 Bacteria 569
130 Ga0495665_0499446 3300046531 Bacteria 613
131 Ga0495656_0745590 3300046615 Unclassified 528
132 Ga0495634_0068785 3300046642 Bacteria 2338
133 Ga0495658_0835508 3300046683 Unclassified 589
134 Ga0495674_0622991 3300047319 Bacteria 853
135 Ga0495684_0218442 3300047471 Bacteria 1399
136 Ga0496114_1329550 3300048917 Unclassified 606
137 Ga0496115_0178305 3300048918 Bacteria 1757
138 Ga0501036_0418095 3300049572 Unclassified 1118
139 Ga0501036_0838152 3300049572 Bacteria 756
140 Ga0501039_0655252 3300049575 Bacteria 822
141 Ga0501041_0575040 3300049577 Unclassified 719
142 Ga0501075_0195247 3300049591 Bacteria 1544
143 Ga0501076_0471804 3300049592 Bacteria 1034
144 Ga0501076_1100209 3300049592 Bacteria 654
145 Ga0501076_1234761 3300049592 Bacteria 615
146 Ga0501079_1378931 3300049741 Unclassified 555
147 Ga0501081_0951266 3300049743 Unclassified 648
148 Ga0501081_0964173 3300049743 Bacteria 644
149 nmdc:mga03n38_300993_c1 3300050490 Bacteria 861
150 nmdc:mga0k408_54190_c1 3300050493 Unclassified 2324
151 nmdc:mga06z11_44692_c1 3300050494 Unclassified 2235
152 nmdc:mga0qj67_350254_c1 3300050509 Bacteria 1194
153 nmdc:mga06r32_313172_c1 3300050510 Unclassified 1555
154 nmdc:mga06r32_698590_c1 3300050510 Unclassified 980
155 nmdc:mga08y16_365066_c1 3300050511 Bacteria 1482
156 nmdc:mga08x19_20046_c1 3300050514 Bacteria 4115
157 Ga0500595_112210 3300053119 Bacteria 774
158 Ga0501084_0179243 3300054114 Bacteria 1789
159 Ga0590071_000045 3300059421 Bacteria 31970
160 Ga0590071_004156 3300059421 Bacteria 3531
161 Ga0590074_001780 3300059423 Unclassified 3519
162 Ga0590075_001744 3300059424 Bacteria 5332
163 Ga0590077_001139 3300059426 Bacteria 6493

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009101 Ga0105247_10166573 Ga0105247_101665732 102
2 3300009177 Ga0105248_10000003 Ga0105248_10000003436 102
3 3300014325 Ga0163163_10225353 Ga0163163_102253532 102
4 3300014968 Ga0157379_10032057 Ga0157379_100320572 102
5 3300025900 Ga0207710_10134991 Ga0207710_101349912 102
6 3300025941 Ga0207711_10000013 Ga0207711_1000001312 102
7 3300053119 Ga0500595_112210 Ga0500595_112210_72_416 102
8 3300005344 Ga0070661_101393861 Ga0070661_1013938612 103
9 3300005355 Ga0070671_100851379 Ga0070671_1008513792 103
10 3300005366 Ga0070659_100338914 Ga0070659_1003389142 103
11 3300005434 Ga0070709_10126666 Ga0070709_101266662 103
12 3300005436 Ga0070713_101008001 Ga0070713_1010080012 103
13 3300005439 Ga0070711_100588378 Ga0070711_1005883781 103
14 3300005539 Ga0068853_100148810 Ga0068853_1001488102 103
15 3300005545 Ga0070695_101005897 Ga0070695_1010058971 103
16 3300005548 Ga0070665_100442459 Ga0070665_1004424592 103
17 3300005563 Ga0068855_100057683 Ga0068855_1000576833 103
18 3300005564 Ga0070664_100712660 Ga0070664_1007126602 103
19 3300005614 Ga0068856_100781676 Ga0068856_1007816762 103
20 3300005616 Ga0068852_102829605 Ga0068852_1028296051 103
21 3300006173 Ga0070716_100338370 Ga0070716_1003383702 103
22 3300006175 Ga0070712_101326446 Ga0070712_1013264462 103
23 3300009093 Ga0105240_10020287 Ga0105240_100202873 103
24 3300009174 Ga0105241_10793970 Ga0105241_107939702 103
25 3300013102 Ga0157371_10815463 Ga0157371_108154632 103
26 3300013104 Ga0157370_10584766 Ga0157370_105847663 103
27 3300013105 Ga0157369_10016752 Ga0157369_100167528 103
28 3300013296 Ga0157374_10037649 Ga0157374_100376494 103
29 3300013307 Ga0157372_10681906 Ga0157372_106819062 103
30 3300014969 Ga0157376_10050688 Ga0157376_100506882 103
31 3300025913 Ga0207695_10110332 Ga0207695_101103323 103
32 3300025916 Ga0207663_10400950 Ga0207663_104009502 103
33 3300025918 Ga0207662_11370129 Ga0207662_113701292 103
34 3300025920 Ga0207649_10096377 Ga0207649_100963773 103
35 3300025939 Ga0207665_10640161 Ga0207665_106401612 103
36 3300025945 Ga0207679_10634688 Ga0207679_106346881 103
37 3300025949 Ga0207667_10085537 Ga0207667_100855372 103
38 3300026041 Ga0207639_10000013 Ga0207639_10000013185 103
39 3300026041 Ga0207639_10005281 Ga0207639_100052812 103
40 3300026142 Ga0207698_12254753 Ga0207698_122547532 103
41 3300028379 Ga0268266_10322649 Ga0268266_103226492 103
42 3300035115 Ga0373941_0172901 Ga0373941_0172901_136_492 103
43 3300035119 Ga0373956_0315321 Ga0373956_0315321_388_723 103
44 3300037068 Ga0373925_0167420 Ga0373925_0167420_149_484 103
45 3300046472 Ga0495580_0473217 Ga0495580_0473217_68_403 103
46 3300046526 Ga0495666_0460771 Ga0495666_0460771_119_454 103
47 3300047319 Ga0495674_0622991 Ga0495674_0622991_29_364 103
48 3300048917 Ga0496114_1329550 Ga0496114_1329550_38_373 103
49 3300048918 Ga0496115_0178305 Ga0496115_0178305_1311_1646 103
50 3300049743 Ga0501081_0951266 Ga0501081_0951266_222_545 103
51 3300049743 Ga0501081_0964173 Ga0501081_0964173_133_456 103
52 2162886012 MBSR1b_contig_10932331 MBSR1b_0132.00005790 104
53 3300005293 Ga0065715_10316580 Ga0065715_103165802 104
54 3300005335 Ga0070666_10954256 Ga0070666_109542561 104
55 3300005347 Ga0070668_101287461 Ga0070668_1012874611 104
56 3300005355 Ga0070671_101834403 Ga0070671_1018344031 104
57 3300005367 Ga0070667_100413139 Ga0070667_1004131392 104
58 3300005434 Ga0070709_10187096 Ga0070709_101870962 104
59 3300005434 Ga0070709_10608259 Ga0070709_106082592 104
60 3300005436 Ga0070713_102313176 Ga0070713_1023131761 104
61 3300005445 Ga0070708_100774241 Ga0070708_1007742412 104
62 3300005456 Ga0070678_101613613 Ga0070678_1016136132 104
63 3300005458 Ga0070681_10090529 Ga0070681_100905294 104
64 3300005467 Ga0070706_100178566 Ga0070706_1001785662 104
65 3300005468 Ga0070707_100894897 Ga0070707_1008948972 104
66 3300005617 Ga0068859_100978831 Ga0068859_1009788312 104
67 3300005719 Ga0068861_100471867 Ga0068861_1004718672 104
68 3300005842 Ga0068858_101257890 Ga0068858_1012578902 104
69 3300005843 Ga0068860_100418010 Ga0068860_1004180101 104
70 3300005843 Ga0068860_102319957 Ga0068860_1023199572 104
71 3300005937 Ga0081455_10010867 Ga0081455_100108671 104
72 3300006042 Ga0075368_10009645 Ga0075368_100096452 104
73 3300006048 Ga0075363_100598079 Ga0075363_1005980792 104
74 3300006178 Ga0075367_10004920 Ga0075367_100049203 104
75 3300006844 Ga0075428_102753539 Ga0075428_1027535392 104
76 3300006846 Ga0075430_100347874 Ga0075430_1003478742 104
77 3300006846 Ga0075430_101117621 Ga0075430_1011176211 104
78 3300006847 Ga0075431_100004019 Ga0075431_1000040194 104
79 3300006847 Ga0075431_100148097 Ga0075431_1001480972 104
80 3300006847 Ga0075431_100784027 Ga0075431_1007840272 104
81 3300006914 Ga0075436_100005938 Ga0075436_1000059383 104
82 3300006914 Ga0075436_100301426 Ga0075436_1003014262 104
83 3300006931 Ga0097620_100978814 Ga0097620_1009788142 104
84 3300009094 Ga0111539_10225339 Ga0111539_102253392 104
85 3300009094 Ga0111539_10777909 Ga0111539_107779091 104
86 3300009177 Ga0105248_10021094 Ga0105248_100210942 104
87 3300009177 Ga0105248_10077533 Ga0105248_100775334 104
88 3300009545 Ga0105237_11524526 Ga0105237_115245262 104
89 3300009551 Ga0105238_12216011 Ga0105238_122160112 104
90 3300009553 Ga0105249_11974121 Ga0105249_119741212 104
91 3300013297 Ga0157378_11094341 Ga0157378_110943411 104
92 3300013308 Ga0157375_10700842 Ga0157375_107008421 104
93 3300014325 Ga0163163_10160998 Ga0163163_101609982 104
94 3300014326 Ga0157380_10117480 Ga0157380_101174802 104
95 3300014968 Ga0157379_10494515 Ga0157379_104945152 104
96 3300014968 Ga0157379_10510657 Ga0157379_105106572 104
97 3300014969 Ga0157376_11644255 Ga0157376_116442552 104
98 3300021388 Ga0213875_10232860 Ga0213875_102328601 104
99 3300025903 Ga0207680_10433369 Ga0207680_104333691 104
100 3300025912 Ga0207707_10179247 Ga0207707_101792472 104
101 3300025914 Ga0207671_10889370 Ga0207671_108893702 104
102 3300025928 Ga0207700_11632211 Ga0207700_116322111 104
103 3300025937 Ga0207669_11264144 Ga0207669_112641442 104
104 3300025941 Ga0207711_10027903 Ga0207711_100279032 104
105 3300025961 Ga0207712_11270790 Ga0207712_112707902 104
106 3300025972 Ga0207668_10743210 Ga0207668_107432102 104
107 3300025986 Ga0207658_10703458 Ga0207658_107034581 104
108 3300026035 Ga0207703_10368575 Ga0207703_103685752 104
109 3300026035 Ga0207703_10529565 Ga0207703_105295651 104
110 3300026118 Ga0207675_100077564 Ga0207675_1000775641 104
111 3300027876 Ga0209974_10040047 Ga0209974_100400471 104
112 3300027907 Ga0207428_10202988 Ga0207428_102029882 104
113 3300028379 Ga0268266_12190604 Ga0268266_121906042 104
114 3300028381 Ga0268264_10358129 Ga0268264_103581292 104
115 3300028381 Ga0268264_12073006 Ga0268264_120730061 104
116 3300031731 Ga0307405_11547088 Ga0307405_115470881 104
117 3300031824 Ga0307413_10830695 Ga0307413_108306951 104
118 3300031995 Ga0307409_101901445 Ga0307409_1019014452 104
119 3300035116 Ga0373945_0297898 Ga0373945_0297898_219_557 104
120 3300035692 Ga0373935_0409622 Ga0373935_0409622_219_557 104
121 3300035695 Ga0373927_0184251 Ga0373927_0184251_871_1209 104
122 3300035695 Ga0373927_0410381 Ga0373927_0410381_21_359 104
123 3300036401 Ga0373937_1493023 Ga0373937_1493023_16_354 104
124 3300036401 Ga0373937_1870539 Ga0373937_1870539_67_405 104
125 3300037853 Ga0436364_0818921 Ga0436364_0818921_717_1088 104
126 3300037853 Ga0436364_1081482 Ga0436364_1081482_251_589 104
127 3300042133 Ga0450896_032211 Ga0450896_032211_59_418 104
128 3300042436 Ga0439435_0045656 Ga0439435_0045656_330_656 104
129 3300042439 Ga0439464_0054909 Ga0439464_0054909_134_472 104
130 3300042439 Ga0439464_0067386 Ga0439464_0067386_133_492 104
131 3300042461 Ga0439460_0179604 Ga0439460_0179604_19_378 104
132 3300042530 Ga0450916_022902 Ga0450916_022902_106_423 104
133 3300042993 Ga0439440_0233706 Ga0439440_0233706_76_414 104
134 3300045051 Ga0451576_0734722 Ga0451576_0734722_11_349 104
135 3300046472 Ga0495580_0015629 Ga0495580_0015629_2225_2563 104
136 3300046531 Ga0495665_0499446 Ga0495665_0499446_83_421 104
137 3300046615 Ga0495656_0745590 Ga0495656_0745590_152_502 104
138 3300046642 Ga0495634_0068785 Ga0495634_0068785_594_932 104
139 3300046683 Ga0495658_0835508 Ga0495658_0835508_237_575 104
140 3300047471 Ga0495684_0218442 Ga0495684_0218442_206_544 104
141 3300049572 Ga0501036_0418095 Ga0501036_0418095_406_762 104
142 3300049572 Ga0501036_0838152 Ga0501036_0838152_371_730 104
143 3300049575 Ga0501039_0655252 Ga0501039_0655252_255_614 104
144 3300049577 Ga0501041_0575040 Ga0501041_0575040_91_450 104
145 3300049591 Ga0501075_0195247 Ga0501075_0195247_333_659 104
146 3300049592 Ga0501076_0471804 Ga0501076_0471804_467_817 104
147 3300049592 Ga0501076_1100209 Ga0501076_1100209_215_553 104
148 3300049592 Ga0501076_1234761 Ga0501076_1234761_47_406 104
149 3300049741 Ga0501079_1378931 Ga0501079_1378931_64_402 104
150 3300050490 nmdc:mga03n38_300993_c1 nmdc:mga03n38_300993_c1_327_692 104
151 3300050493 nmdc:mga0k408_54190_c1 nmdc:mga0k408_54190_c1_283_648 104
152 3300050494 nmdc:mga06z11_44692_c1 nmdc:mga06z11_44692_c1_1396_1761 104
153 3300050509 nmdc:mga0qj67_350254_c1 nmdc:mga0qj67_350254_c1_293_652 104
154 3300050510 nmdc:mga06r32_313172_c1 nmdc:mga06r32_313172_c1_871_1230 104
155 3300050510 nmdc:mga06r32_698590_c1 nmdc:mga06r32_698590_c1_190_555 104
156 3300050511 nmdc:mga08y16_365066_c1 nmdc:mga08y16_365066_c1_1120_1434 104
157 3300050514 nmdc:mga08x19_20046_c1 nmdc:mga08x19_20046_c1_24_365 104
158 3300054114 Ga0501084_0179243 Ga0501084_0179243_328_654 104
159 3300059421 Ga0590071_000045 Ga0590071_000045_4835_5194 104
160 3300059421 Ga0590071_004156 Ga0590071_004156_965_1324 104
161 3300059423 Ga0590074_001780 Ga0590074_001780_2132_2491 104
162 3300059424 Ga0590075_001744 Ga0590075_001744_270_629 104
163 3300059426 Ga0590077_001139 Ga0590077_001139_1302_1715 104

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

20

135

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zo7-assembly1.cif.gz_F crystal structure of clcfe27a with substrate 0.7208 2 104
4fpi-assembly1.cif.gz_C crystal structure of 5-chloromuconolactone isomerase from rhodococcus opacus 1cp 0.6878 2 104
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.6877 2 103
3znj-assembly1.cif.gz_3 crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. 0.6871 2 104
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.672 2 103
ID Description Score Start End Superfamily
af_Q5A0W4_540_618_3.30.70.1350 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Cation efflux protein, cytoplasmic domain 0.7992 13 40 3.30.70.1350
3znj100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7034 2 104 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6877 2 103 3.30.70.1060
af_Q54X77_2_73_1.10.238.10 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.6783 12 37 1.10.238.10
af_Q91ZR4_1_82_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.6749 2 42 3.30.200.20
ID Description Score Start End GO Terms
AF-A0A7V8SVA5-F1-model_v4 Transcription initiation protein 0.87 2 104
AF-A0A7V8SVA5-F1-model_v4 Transcription initiation protein 0.8544 2 104
AF-A0A317IEM6-F1-model_v4 YCII-related domain-containing protein 0.8454 2 104
AF-A0A2V8VDM2-F1-model_v4 YCII-related domain-containing protein 0.8385 13 104
AF-A0A317IEM6-F1-model_v4 YCII-related domain-containing protein 0.8308 2 104

Feature Viewer

pLDDT pTM Quality
83.79 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map