F242124

General Info

Members Datasets Scaffolds Average Seq Length
163 107 326 258

Family's Representative Sequence

Representative Sequence 3300038726|Ga0400490_06605|Ga0400490_06605_1257_2159
Length 300
Sequence MIGGVPIRVHPETALFRMDTSLTQLPKRAIHFRVGATEETCKMKFRPCIDLHGGKVKQIVGGTLSDGSDSALQTNFEADRPAQWYAQRYRSDGLDGGHVIRLGPGNKKAAEAALAVWPGGMQLGGGVTVDNARKWLDAGASAVIVTSWVFHGGQVDYSRLKQLSQSIGAERLVLDLSCRRRDDAYFIVTDRWQNFTRECITPRLLSQLAQYCAEYLIHAVDVEGKCRGIETPLVELLGRWAGLPTTYAGGIHSQADIDTIFRLGGGAIDFTVGSALDIFGGSGFRYQVLARRYRGADHAS

Samples

Sample ID Description Type Environment
1 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
36 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
37 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
52 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
53 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
54 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
55 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
56 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
57 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
58 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
59 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
60 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
61 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
62 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
63 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
64 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
65 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
66 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
67 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
68 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
69 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
70 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
71 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
72 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
73 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
74 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
75 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
76 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
77 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
78 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
79 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
80 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
81 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
82 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
83 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
84 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
85 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
86 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
87 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
88 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
89 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
90 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
91 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
92 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
93 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
94 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
95 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
96 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
97 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
99 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
100 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
101 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
102 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
103 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
104 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
105 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
106 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
107 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.77
Metatranscriptomes 0.61
Isolates 0.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.5
Nodule 0
Rhizoplane 0
Rhizosphere 67.48
Stem 0
Stem Tuber 0
Unclassified 14.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400490_06605 3300038726 Bacteria 2468
2 rootH2_10004307 3300003320 Bacteria 43872
3 rootH2_10035337 3300003320 Bacteria 5384
4 rootH1_10047319 3300003323 Bacteria 9802
5 rootH1_10123037 3300003323 Bacteria 6381
6 Ga0070658_10029718 3300005327 Unclassified 4391
7 Ga0070683_100606868 3300005329 Bacteria 1047
8 Ga0070670_100102552 3300005331 Bacteria 2464
9 Ga0070677_10047525 3300005333 Bacteria 1721
10 Ga0070660_100022345 3300005339 Bacteria 4676
11 Ga0070660_100211180 3300005339 Bacteria 1576
12 Ga0070689_100010469 3300005340 Bacteria 6610
13 Ga0070689_100177018 3300005340 Bacteria 1731
14 Ga0070675_100522349 3300005354 Bacteria 1071
15 Ga0070674_100625725 3300005356 Bacteria 912
16 Ga0070713_100270734 3300005436 Bacteria 1555
17 Ga0070672_100000111 3300005543 Bacteria 41141
18 Ga0068855_100004715 3300005563 Bacteria 16659
19 Ga0068857_100267396 3300005577 Unclassified 1571
20 Ga0068856_100000089 3300005614 Bacteria 85631
21 Ga0068856_100551126 3300005614 Bacteria 1174
22 Ga0070702_100104875 3300005615 Bacteria 1741
23 Ga0068864_100514214 3300005618 Bacteria 1153
24 Ga0068864_100990214 3300005618 Unclassified 833
25 Ga0068860_100031751 3300005843 Bacteria 5078
26 Ga0075368_10040086 3300006042 Bacteria 1838
27 Ga0075363_100040038 3300006048 Bacteria 2469
28 Ga0075363_100088270 3300006048 Bacteria 1704
29 Ga0075363_100095906 3300006048 Bacteria 1637
30 Ga0075364_10023056 3300006051 Bacteria 3938
31 Ga0075364_10095048 3300006051 Unclassified 1981
32 Ga0075364_10223087 3300006051 Bacteria 1279
33 Ga0075364_10272888 3300006051 Unclassified 1150
34 Ga0075362_10077519 3300006177 Bacteria 1527
35 Ga0075367_10151273 3300006178 Bacteria 1440
36 Ga0075369_10132469 3300006186 Bacteria 1133
37 Ga0097621_100141995 3300006237 Bacteria 2053
38 Ga0075436_100433176 3300006914 Bacteria 956
39 Ga0105240_10001266 3300009093 Bacteria 43729
40 Ga0105240_10118113 3300009093 Unclassified 3197
41 Ga0111539_10237113 3300009094 Bacteria 2123
42 Ga0105241_10002598 3300009174 Bacteria 13540
43 Ga0105242_10976826 3300009176 Unclassified 853
44 Ga0163162_10897227 3300013306 Bacteria 1000
45 Ga0157375_10000113 3300013308 Bacteria 78155
46 Ga0163163_10001288 3300014325 Bacteria 21171
47 Ga0157376_10035393 3300014969 Unclassified 4039
48 Ga0213875_10001282 3300021388 Bacteria 16807
49 Ga0207682_10028180 3300025893 Unclassified 2241
50 Ga0207695_10017840 3300025913 Bacteria 8227
51 Ga0207695_10289862 3300025913 Bacteria 1529
52 Ga0207657_10307250 3300025919 Unclassified 1256
53 Ga0207659_10254535 3300025926 Bacteria 1426
54 Ga0207700_10213175 3300025928 Bacteria 1634
55 Ga0207670_10136649 3300025936 Bacteria 1803
56 Ga0207670_10173343 3300025936 Bacteria 1619
57 Ga0207670_10256895 3300025936 Bacteria 1353
58 Ga0207704_10222908 3300025938 Bacteria 1397
59 Ga0207691_10000500 3300025940 Bacteria 39019
60 Ga0207667_10014119 3300025949 Bacteria 9116
61 Ga0207702_10036223 3300026078 Bacteria 4126
62 Ga0207702_10205913 3300026078 Unclassified 1826
63 Ga0207641_10001497 3300026088 Bacteria 22866
64 Ga0207641_10428635 3300026088 Bacteria 1275
65 Ga0207676_10503178 3300026095 Bacteria 1151
66 Ga0207674_10361712 3300026116 Unclassified 1403
67 Ga0207674_10502142 3300026116 Bacteria 1172
68 Ga0268264_10025439 3300028381 Bacteria 4836
69 Ga0265337_1017484 3300028556 Unclassified 2299
70 Ga0265326_10004005 3300028558 Bacteria 4768
71 Ga0265319_1003824 3300028563 Bacteria 7710
72 Ga0265318_10046507 3300028577 Unclassified 1637
73 Ga0265338_10000008 3300028800 Bacteria 481542
74 Ga0265338_10007353 3300028800 Bacteria 13715
75 Ga0265338_10014825 3300028800 Bacteria 8626
76 Ga0265338_10028565 3300028800 Bacteria 5558
77 Ga0265338_10085830 3300028800 Unclassified 2622
78 Ga0265338_10132366 3300028800 Unclassified 1966
79 Ga0265327_10004597 3300031251 Bacteria 12134
80 Ga0307513_10097897 3300031456 Bacteria 2967
81 Ga0316579_10010654 3300031691 Bacteria 3891
82 Ga0316576_10168444 3300031727 Bacteria 1653
83 Ga0316592_1027982 3300033524 Bacteria 1220
84 Ga0316574_0080984 3300035398 Bacteria 2062
85 Ga0316574_0186379 3300035398 Bacteria 1335
86 Ga0373927_0004366 3300035695 Bacteria 9916
87 Ga0373947_0003528 3300035725 Bacteria 9236
88 Ga0373925_0002758 3300037068 Bacteria 13900
89 Ga0395898_0125769 3300037466 Bacteria 2456
90 Ga0436364_0434016 3300037853 Bacteria 10141
91 Ga0400484_20244 3300038725 Bacteria 1487
92 Ga0400484_33173 3300038725 Bacteria 1968
93 Ga0400490_09006 3300038726 Bacteria 131367
94 Ga0400490_46894 3300038726 Unclassified 1388
95 Ga0400490_55234 3300038726 Bacteria 5775
96 Ga0400490_58141 3300038726 Bacteria 1958
97 Ga0400491_16491 3300038727 Bacteria 3158
98 Ga0400485_14363 3300038735 Bacteria 18796
99 Ga0400485_20797 3300038735 Bacteria 24782
100 Ga0400488_26924 3300038741 Bacteria 13769
101 Ga0400488_35738 3300038741 Bacteria 6705
102 Ga0400488_40439 3300038741 Bacteria 3685
103 Ga0400486_06093 3300038742 Bacteria 9677
104 Ga0400486_20466 3300038742 Bacteria 33975
105 Ga0400486_22667 3300038742 Bacteria 15811
106 Ga0400483_060986 3300039062 Bacteria 5112
107 Ga0400483_071935 3300039062 Bacteria 165886
108 Ga0400483_159233 3300039062 Bacteria 1113
109 Ga0400483_249988 3300039062 Bacteria 1104
110 Ga0400489_03161 3300039093 Bacteria 12581
111 Ga0400489_46726 3300039093 Bacteria 23679
112 Ga0400487_55931 3300039110 Bacteria 1161
113 Ga0451577_0006964 3300042876 Bacteria 11166
114 Ga0451577_0008790 3300042876 Bacteria 9786
115 Ga0451577_0021282 3300042876 Bacteria 5936
116 Ga0451577_0072432 3300042876 Unclassified 3074
117 Ga0451577_0083320 3300042876 Bacteria 2853
118 Ga0451577_0207924 3300042876 Bacteria 1767
119 Ga0466972_0030573 3300044658 Bacteria 2650
120 Ga0453683_0000379 3300044673 Bacteria 53272
121 Ga0453683_0004562 3300044673 Bacteria 9802
122 Ga0466965_0031599 3300044683 Bacteria 2582
123 Ga0453684_0000942 3300044712 Bacteria 95890
124 Ga0453684_0009041 3300044712 Bacteria 17582
125 Ga0453684_0014757 3300044712 Bacteria 12453
126 Ga0453684_0029663 3300044712 Bacteria 7756
127 Ga0453684_0034481 3300044712 Bacteria 7025
128 Ga0453684_0050520 3300044712 Bacteria 5468
129 Ga0466960_0012243 3300044901 Bacteria 3614
130 Ga0451576_0011952 3300045051 Bacteria 9811
131 Ga0495592_0000081 3300046454 Bacteria 83319
132 Ga0495662_0028962 3300046476 Bacteria 2674
133 Ga0495628_0001865 3300046516 Bacteria 19126
134 Ga0495630_0029698 3300046517 Bacteria 4064
135 Ga0495640_0007601 3300046533 Bacteria 8516
136 Ga0495586_0000421 3300046535 Bacteria 25725
137 Ga0495645_0327226 3300046543 Bacteria 993
138 Ga0495667_0338589 3300046559 Bacteria 951
139 Ga0495674_0327353 3300047319 Bacteria 1247
140 Ga0495676_0053077 3300047321 Bacteria 3233
141 Ga0501073_0008135 3300049589 Bacteria 7780
142 Ga0501075_0400786 3300049591 Unclassified 1046
143 Ga0501076_0103142 3300049592 Bacteria 2301
144 Ga0501080_0034253 3300049742 Bacteria 4740
145 Ga0501080_0108512 3300049742 Bacteria 2572
146 Ga0501083_0002189 3300049744 Bacteria 13369
147 Ga0501083_0012677 3300049744 Bacteria 5898
148 Ga0501035_0072711 3300049822 Unclassified 3043
149 Ga0501044_0520575 3300049823 Unclassified 1089
150 nmdc:mga03683_82995_c1 3300050489 Bacteria 1387
151 nmdc:mga03n38_38621_c1 3300050490 Bacteria 2066
152 nmdc:mga03n38_44783_c1 3300050490 Bacteria 1946
153 nmdc:mga00v17_13243_c1 3300050491 Bacteria 4572
154 nmdc:mga00v17_173528_c1 3300050491 Bacteria 1391
155 nmdc:mga00v17_181573_c1 3300050491 Unclassified 1358
156 nmdc:mga00v17_195823_c1 3300050491 Bacteria 1306
157 nmdc:mga00v17_9617_c1 3300050491 Bacteria 5241
158 nmdc:mga0yw44_359389_c1 3300050492 Bacteria 981
159 nmdc:mga08y16_335329_c1 3300050511 Unclassified 1555
160 nmdc:mga0sz30_131523_c1 3300050516 Bacteria 1103
161 Ga0495601_0124862 3300053077 Bacteria 1674
162 Ga0500616_0015404 3300053153 Unclassified 4373
163 2925330435 2925326138 Bacteria 9652120
164 Ga0400490_06605
165 rootH2_10004307
166 rootH2_10035337
167 rootH1_10047319
168 rootH1_10123037
169 Ga0070658_10029718
170 Ga0070683_100606868
171 Ga0070670_100102552
172 Ga0070677_10047525
173 Ga0070660_100022345
174 Ga0070660_100211180
175 Ga0070689_100010469
176 Ga0070689_100177018
177 Ga0070675_100522349
178 Ga0070674_100625725
179 Ga0070713_100270734
180 Ga0070672_100000111
181 Ga0068855_100004715
182 Ga0068857_100267396
183 Ga0068856_100000089
184 Ga0068856_100551126
185 Ga0070702_100104875
186 Ga0068864_100514214
187 Ga0068864_100990214
188 Ga0068860_100031751
189 Ga0075368_10040086
190 Ga0075363_100040038
191 Ga0075363_100088270
192 Ga0075363_100095906
193 Ga0075364_10023056
194 Ga0075364_10095048
195 Ga0075364_10223087
196 Ga0075364_10272888
197 Ga0075362_10077519
198 Ga0075367_10151273
199 Ga0075369_10132469
200 Ga0097621_100141995
201 Ga0075436_100433176
202 Ga0105240_10001266
203 Ga0105240_10118113
204 Ga0111539_10237113
205 Ga0105241_10002598
206 Ga0105242_10976826
207 Ga0163162_10897227
208 Ga0157375_10000113
209 Ga0163163_10001288
210 Ga0157376_10035393
211 Ga0213875_10001282
212 Ga0207682_10028180
213 Ga0207695_10017840
214 Ga0207695_10289862
215 Ga0207657_10307250
216 Ga0207659_10254535
217 Ga0207700_10213175
218 Ga0207670_10136649
219 Ga0207670_10173343
220 Ga0207670_10256895
221 Ga0207704_10222908
222 Ga0207691_10000500
223 Ga0207667_10014119
224 Ga0207702_10036223
225 Ga0207702_10205913
226 Ga0207641_10001497
227 Ga0207641_10428635
228 Ga0207676_10503178
229 Ga0207674_10361712
230 Ga0207674_10502142
231 Ga0268264_10025439
232 Ga0265337_1017484
233 Ga0265326_10004005
234 Ga0265319_1003824
235 Ga0265318_10046507
236 Ga0265338_10000008
237 Ga0265338_10007353
238 Ga0265338_10014825
239 Ga0265338_10028565
240 Ga0265338_10085830
241 Ga0265338_10132366
242 Ga0265327_10004597
243 Ga0307513_10097897
244 Ga0316579_10010654
245 Ga0316576_10168444
246 Ga0316592_1027982
247 Ga0316574_0080984
248 Ga0316574_0186379
249 Ga0373927_0004366
250 Ga0373947_0003528
251 Ga0373925_0002758
252 Ga0395898_0125769
253 Ga0436364_0434016
254 Ga0400484_20244
255 Ga0400484_33173
256 Ga0400490_09006
257 Ga0400490_46894
258 Ga0400490_55234
259 Ga0400490_58141
260 Ga0400491_16491
261 Ga0400485_14363
262 Ga0400485_20797
263 Ga0400488_26924
264 Ga0400488_35738
265 Ga0400488_40439
266 Ga0400486_06093
267 Ga0400486_20466
268 Ga0400486_22667
269 Ga0400483_060986
270 Ga0400483_071935
271 Ga0400483_159233
272 Ga0400483_249988
273 Ga0400489_03161
274 Ga0400489_46726
275 Ga0400487_55931
276 Ga0451577_0006964
277 Ga0451577_0008790
278 Ga0451577_0021282
279 Ga0451577_0072432
280 Ga0451577_0083320
281 Ga0451577_0207924
282 Ga0466972_0030573
283 Ga0453683_0000379
284 Ga0453683_0004562
285 Ga0466965_0031599
286 Ga0453684_0000942
287 Ga0453684_0009041
288 Ga0453684_0014757
289 Ga0453684_0029663
290 Ga0453684_0034481
291 Ga0453684_0050520
292 Ga0466960_0012243
293 Ga0451576_0011952
294 Ga0495592_0000081
295 Ga0495662_0028962
296 Ga0495628_0001865
297 Ga0495630_0029698
298 Ga0495640_0007601
299 Ga0495586_0000421
300 Ga0495645_0327226
301 Ga0495667_0338589
302 Ga0495674_0327353
303 Ga0495676_0053077
304 Ga0501073_0008135
305 Ga0501075_0400786
306 Ga0501076_0103142
307 Ga0501080_0034253
308 Ga0501080_0108512
309 Ga0501083_0002189
310 Ga0501083_0012677
311 Ga0501035_0072711
312 Ga0501044_0520575
313 nmdc:mga03683_82995_c1
314 nmdc:mga03n38_38621_c1
315 nmdc:mga03n38_44783_c1
316 nmdc:mga00v17_13243_c1
317 nmdc:mga00v17_173528_c1
318 nmdc:mga00v17_181573_c1
319 nmdc:mga00v17_195823_c1
320 nmdc:mga00v17_9617_c1
321 nmdc:mga0yw44_359389_c1
322 nmdc:mga08y16_335329_c1
323 nmdc:mga0sz30_131523_c1
324 Ga0495601_0124862
325 Ga0500616_0015404
326 2925330435

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00977

His_biosynth

Histidine biosynthesis protein

44

280

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2agk-assembly1.cif.gz_A structure of s. cerevisiae his6 protein 0.9464 2 251
2agk-assembly1.cif.gz_A structure of s. cerevisiae his6 protein 0.9345 2 251
3tdm-assembly2.cif.gz_C computationally designed tim-barrel protein, halfflr 0.9029 127 229
3tdn-assembly1.cif.gz_A computationally designed two-fold symmetric tim-barrel protein, flr 0.897 127 229
2y88-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis phosphoribosyl isomerase (variant d11n) with bound prfar 0.8518 1 229
ID Description Score Start End Superfamily
af_O82782_44_301_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9784 2 251 3.20.20.70
af_O82782_44_301_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9669 2 251 3.20.20.70
af_A0A1D8PMD0_2_276_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9543 2 251 3.20.20.70
2agkA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9464 2 251 3.20.20.70
af_A0A1D8PMD0_2_276_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9432 2 251 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2V6F2B4-F1-model_v4 5-proFAR isomerase (Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase) 0.9946 33 248 GO:0000105
GO:0000162
GO:0003949
GO:0005737
AF-A0A357TDZ5-F1-model_v4 Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase 0.9941 94 250 GO:0000105
GO:0000162
GO:0003949
GO:0005737
AF-A0A355SY00-F1-model_v4 Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase 0.9931 121 248 GO:0000105
GO:0000162
GO:0003949
GO:0005737
AF-A0A6N6Q3F0-F1-model_v4 5-proFAR isomerase (Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase) 0.9924 77 249 GO:0000105
GO:0000162
GO:0003949
GO:0005737
AF-A0A2S4VXY3-F1-model_v4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (EC 5.3.1.16) (5-proFAR isomerase) (Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase) 0.9904 80 251 GO:0000105
GO:0000162
GO:0003949
GO:0005737

Map