F242124
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 163 | 107 | 326 | 258 |
Family's Representative Sequence
| Representative Sequence | 3300038726|Ga0400490_06605|Ga0400490_06605_1257_2159 |
| Length | 300 |
| Sequence | MIGGVPIRVHPETALFRMDTSLTQLPKRAIHFRVGATEETCKMKFRPCIDLHGGKVKQIVGGTLSDGSDSALQTNFEADRPAQWYAQRYRSDGLDGGHVIRLGPGNKKAAEAALAVWPGGMQLGGGVTVDNARKWLDAGASAVIVTSWVFHGGQVDYSRLKQLSQSIGAERLVLDLSCRRRDDAYFIVTDRWQNFTRECITPRLLSQLAQYCAEYLIHAVDVEGKCRGIETPLVELLGRWAGLPTTYAGGIHSQADIDTIFRLGGGAIDFTVGSALDIFGGSGFRYQVLARRYRGADHAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 15 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 16 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 17 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 19 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 20 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 21 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 22 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 23 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 24 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 25 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 26 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 27 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 28 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 37 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 52 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 53 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 54 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 55 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 56 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 57 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 58 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 59 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 60 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 61 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 62 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 63 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 64 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 65 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 66 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 67 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 68 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 69 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 70 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 71 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 72 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 73 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 74 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 75 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 76 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 77 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 78 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 79 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 80 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 81 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 82 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 93 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 94 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 95 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 96 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 97 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 98 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 99 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 100 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 101 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 102 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 103 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 104 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 105 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 107 | 2925326138 | Paenibacillus hemerocallicola KCTC 33185 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.77 |
| Metatranscriptomes | 0.61 |
| Isolates | 0.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.5 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 67.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.72 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0400490_06605 | 3300038726 | Bacteria | 2468 |
| 2 | rootH2_10004307 | 3300003320 | Bacteria | 43872 |
| 3 | rootH2_10035337 | 3300003320 | Bacteria | 5384 |
| 4 | rootH1_10047319 | 3300003323 | Bacteria | 9802 |
| 5 | rootH1_10123037 | 3300003323 | Bacteria | 6381 |
| 6 | Ga0070658_10029718 | 3300005327 | Unclassified | 4391 |
| 7 | Ga0070683_100606868 | 3300005329 | Bacteria | 1047 |
| 8 | Ga0070670_100102552 | 3300005331 | Bacteria | 2464 |
| 9 | Ga0070677_10047525 | 3300005333 | Bacteria | 1721 |
| 10 | Ga0070660_100022345 | 3300005339 | Bacteria | 4676 |
| 11 | Ga0070660_100211180 | 3300005339 | Bacteria | 1576 |
| 12 | Ga0070689_100010469 | 3300005340 | Bacteria | 6610 |
| 13 | Ga0070689_100177018 | 3300005340 | Bacteria | 1731 |
| 14 | Ga0070675_100522349 | 3300005354 | Bacteria | 1071 |
| 15 | Ga0070674_100625725 | 3300005356 | Bacteria | 912 |
| 16 | Ga0070713_100270734 | 3300005436 | Bacteria | 1555 |
| 17 | Ga0070672_100000111 | 3300005543 | Bacteria | 41141 |
| 18 | Ga0068855_100004715 | 3300005563 | Bacteria | 16659 |
| 19 | Ga0068857_100267396 | 3300005577 | Unclassified | 1571 |
| 20 | Ga0068856_100000089 | 3300005614 | Bacteria | 85631 |
| 21 | Ga0068856_100551126 | 3300005614 | Bacteria | 1174 |
| 22 | Ga0070702_100104875 | 3300005615 | Bacteria | 1741 |
| 23 | Ga0068864_100514214 | 3300005618 | Bacteria | 1153 |
| 24 | Ga0068864_100990214 | 3300005618 | Unclassified | 833 |
| 25 | Ga0068860_100031751 | 3300005843 | Bacteria | 5078 |
| 26 | Ga0075368_10040086 | 3300006042 | Bacteria | 1838 |
| 27 | Ga0075363_100040038 | 3300006048 | Bacteria | 2469 |
| 28 | Ga0075363_100088270 | 3300006048 | Bacteria | 1704 |
| 29 | Ga0075363_100095906 | 3300006048 | Bacteria | 1637 |
| 30 | Ga0075364_10023056 | 3300006051 | Bacteria | 3938 |
| 31 | Ga0075364_10095048 | 3300006051 | Unclassified | 1981 |
| 32 | Ga0075364_10223087 | 3300006051 | Bacteria | 1279 |
| 33 | Ga0075364_10272888 | 3300006051 | Unclassified | 1150 |
| 34 | Ga0075362_10077519 | 3300006177 | Bacteria | 1527 |
| 35 | Ga0075367_10151273 | 3300006178 | Bacteria | 1440 |
| 36 | Ga0075369_10132469 | 3300006186 | Bacteria | 1133 |
| 37 | Ga0097621_100141995 | 3300006237 | Bacteria | 2053 |
| 38 | Ga0075436_100433176 | 3300006914 | Bacteria | 956 |
| 39 | Ga0105240_10001266 | 3300009093 | Bacteria | 43729 |
| 40 | Ga0105240_10118113 | 3300009093 | Unclassified | 3197 |
| 41 | Ga0111539_10237113 | 3300009094 | Bacteria | 2123 |
| 42 | Ga0105241_10002598 | 3300009174 | Bacteria | 13540 |
| 43 | Ga0105242_10976826 | 3300009176 | Unclassified | 853 |
| 44 | Ga0163162_10897227 | 3300013306 | Bacteria | 1000 |
| 45 | Ga0157375_10000113 | 3300013308 | Bacteria | 78155 |
| 46 | Ga0163163_10001288 | 3300014325 | Bacteria | 21171 |
| 47 | Ga0157376_10035393 | 3300014969 | Unclassified | 4039 |
| 48 | Ga0213875_10001282 | 3300021388 | Bacteria | 16807 |
| 49 | Ga0207682_10028180 | 3300025893 | Unclassified | 2241 |
| 50 | Ga0207695_10017840 | 3300025913 | Bacteria | 8227 |
| 51 | Ga0207695_10289862 | 3300025913 | Bacteria | 1529 |
| 52 | Ga0207657_10307250 | 3300025919 | Unclassified | 1256 |
| 53 | Ga0207659_10254535 | 3300025926 | Bacteria | 1426 |
| 54 | Ga0207700_10213175 | 3300025928 | Bacteria | 1634 |
| 55 | Ga0207670_10136649 | 3300025936 | Bacteria | 1803 |
| 56 | Ga0207670_10173343 | 3300025936 | Bacteria | 1619 |
| 57 | Ga0207670_10256895 | 3300025936 | Bacteria | 1353 |
| 58 | Ga0207704_10222908 | 3300025938 | Bacteria | 1397 |
| 59 | Ga0207691_10000500 | 3300025940 | Bacteria | 39019 |
| 60 | Ga0207667_10014119 | 3300025949 | Bacteria | 9116 |
| 61 | Ga0207702_10036223 | 3300026078 | Bacteria | 4126 |
| 62 | Ga0207702_10205913 | 3300026078 | Unclassified | 1826 |
| 63 | Ga0207641_10001497 | 3300026088 | Bacteria | 22866 |
| 64 | Ga0207641_10428635 | 3300026088 | Bacteria | 1275 |
| 65 | Ga0207676_10503178 | 3300026095 | Bacteria | 1151 |
| 66 | Ga0207674_10361712 | 3300026116 | Unclassified | 1403 |
| 67 | Ga0207674_10502142 | 3300026116 | Bacteria | 1172 |
| 68 | Ga0268264_10025439 | 3300028381 | Bacteria | 4836 |
| 69 | Ga0265337_1017484 | 3300028556 | Unclassified | 2299 |
| 70 | Ga0265326_10004005 | 3300028558 | Bacteria | 4768 |
| 71 | Ga0265319_1003824 | 3300028563 | Bacteria | 7710 |
| 72 | Ga0265318_10046507 | 3300028577 | Unclassified | 1637 |
| 73 | Ga0265338_10000008 | 3300028800 | Bacteria | 481542 |
| 74 | Ga0265338_10007353 | 3300028800 | Bacteria | 13715 |
| 75 | Ga0265338_10014825 | 3300028800 | Bacteria | 8626 |
| 76 | Ga0265338_10028565 | 3300028800 | Bacteria | 5558 |
| 77 | Ga0265338_10085830 | 3300028800 | Unclassified | 2622 |
| 78 | Ga0265338_10132366 | 3300028800 | Unclassified | 1966 |
| 79 | Ga0265327_10004597 | 3300031251 | Bacteria | 12134 |
| 80 | Ga0307513_10097897 | 3300031456 | Bacteria | 2967 |
| 81 | Ga0316579_10010654 | 3300031691 | Bacteria | 3891 |
| 82 | Ga0316576_10168444 | 3300031727 | Bacteria | 1653 |
| 83 | Ga0316592_1027982 | 3300033524 | Bacteria | 1220 |
| 84 | Ga0316574_0080984 | 3300035398 | Bacteria | 2062 |
| 85 | Ga0316574_0186379 | 3300035398 | Bacteria | 1335 |
| 86 | Ga0373927_0004366 | 3300035695 | Bacteria | 9916 |
| 87 | Ga0373947_0003528 | 3300035725 | Bacteria | 9236 |
| 88 | Ga0373925_0002758 | 3300037068 | Bacteria | 13900 |
| 89 | Ga0395898_0125769 | 3300037466 | Bacteria | 2456 |
| 90 | Ga0436364_0434016 | 3300037853 | Bacteria | 10141 |
| 91 | Ga0400484_20244 | 3300038725 | Bacteria | 1487 |
| 92 | Ga0400484_33173 | 3300038725 | Bacteria | 1968 |
| 93 | Ga0400490_09006 | 3300038726 | Bacteria | 131367 |
| 94 | Ga0400490_46894 | 3300038726 | Unclassified | 1388 |
| 95 | Ga0400490_55234 | 3300038726 | Bacteria | 5775 |
| 96 | Ga0400490_58141 | 3300038726 | Bacteria | 1958 |
| 97 | Ga0400491_16491 | 3300038727 | Bacteria | 3158 |
| 98 | Ga0400485_14363 | 3300038735 | Bacteria | 18796 |
| 99 | Ga0400485_20797 | 3300038735 | Bacteria | 24782 |
| 100 | Ga0400488_26924 | 3300038741 | Bacteria | 13769 |
| 101 | Ga0400488_35738 | 3300038741 | Bacteria | 6705 |
| 102 | Ga0400488_40439 | 3300038741 | Bacteria | 3685 |
| 103 | Ga0400486_06093 | 3300038742 | Bacteria | 9677 |
| 104 | Ga0400486_20466 | 3300038742 | Bacteria | 33975 |
| 105 | Ga0400486_22667 | 3300038742 | Bacteria | 15811 |
| 106 | Ga0400483_060986 | 3300039062 | Bacteria | 5112 |
| 107 | Ga0400483_071935 | 3300039062 | Bacteria | 165886 |
| 108 | Ga0400483_159233 | 3300039062 | Bacteria | 1113 |
| 109 | Ga0400483_249988 | 3300039062 | Bacteria | 1104 |
| 110 | Ga0400489_03161 | 3300039093 | Bacteria | 12581 |
| 111 | Ga0400489_46726 | 3300039093 | Bacteria | 23679 |
| 112 | Ga0400487_55931 | 3300039110 | Bacteria | 1161 |
| 113 | Ga0451577_0006964 | 3300042876 | Bacteria | 11166 |
| 114 | Ga0451577_0008790 | 3300042876 | Bacteria | 9786 |
| 115 | Ga0451577_0021282 | 3300042876 | Bacteria | 5936 |
| 116 | Ga0451577_0072432 | 3300042876 | Unclassified | 3074 |
| 117 | Ga0451577_0083320 | 3300042876 | Bacteria | 2853 |
| 118 | Ga0451577_0207924 | 3300042876 | Bacteria | 1767 |
| 119 | Ga0466972_0030573 | 3300044658 | Bacteria | 2650 |
| 120 | Ga0453683_0000379 | 3300044673 | Bacteria | 53272 |
| 121 | Ga0453683_0004562 | 3300044673 | Bacteria | 9802 |
| 122 | Ga0466965_0031599 | 3300044683 | Bacteria | 2582 |
| 123 | Ga0453684_0000942 | 3300044712 | Bacteria | 95890 |
| 124 | Ga0453684_0009041 | 3300044712 | Bacteria | 17582 |
| 125 | Ga0453684_0014757 | 3300044712 | Bacteria | 12453 |
| 126 | Ga0453684_0029663 | 3300044712 | Bacteria | 7756 |
| 127 | Ga0453684_0034481 | 3300044712 | Bacteria | 7025 |
| 128 | Ga0453684_0050520 | 3300044712 | Bacteria | 5468 |
| 129 | Ga0466960_0012243 | 3300044901 | Bacteria | 3614 |
| 130 | Ga0451576_0011952 | 3300045051 | Bacteria | 9811 |
| 131 | Ga0495592_0000081 | 3300046454 | Bacteria | 83319 |
| 132 | Ga0495662_0028962 | 3300046476 | Bacteria | 2674 |
| 133 | Ga0495628_0001865 | 3300046516 | Bacteria | 19126 |
| 134 | Ga0495630_0029698 | 3300046517 | Bacteria | 4064 |
| 135 | Ga0495640_0007601 | 3300046533 | Bacteria | 8516 |
| 136 | Ga0495586_0000421 | 3300046535 | Bacteria | 25725 |
| 137 | Ga0495645_0327226 | 3300046543 | Bacteria | 993 |
| 138 | Ga0495667_0338589 | 3300046559 | Bacteria | 951 |
| 139 | Ga0495674_0327353 | 3300047319 | Bacteria | 1247 |
| 140 | Ga0495676_0053077 | 3300047321 | Bacteria | 3233 |
| 141 | Ga0501073_0008135 | 3300049589 | Bacteria | 7780 |
| 142 | Ga0501075_0400786 | 3300049591 | Unclassified | 1046 |
| 143 | Ga0501076_0103142 | 3300049592 | Bacteria | 2301 |
| 144 | Ga0501080_0034253 | 3300049742 | Bacteria | 4740 |
| 145 | Ga0501080_0108512 | 3300049742 | Bacteria | 2572 |
| 146 | Ga0501083_0002189 | 3300049744 | Bacteria | 13369 |
| 147 | Ga0501083_0012677 | 3300049744 | Bacteria | 5898 |
| 148 | Ga0501035_0072711 | 3300049822 | Unclassified | 3043 |
| 149 | Ga0501044_0520575 | 3300049823 | Unclassified | 1089 |
| 150 | nmdc:mga03683_82995_c1 | 3300050489 | Bacteria | 1387 |
| 151 | nmdc:mga03n38_38621_c1 | 3300050490 | Bacteria | 2066 |
| 152 | nmdc:mga03n38_44783_c1 | 3300050490 | Bacteria | 1946 |
| 153 | nmdc:mga00v17_13243_c1 | 3300050491 | Bacteria | 4572 |
| 154 | nmdc:mga00v17_173528_c1 | 3300050491 | Bacteria | 1391 |
| 155 | nmdc:mga00v17_181573_c1 | 3300050491 | Unclassified | 1358 |
| 156 | nmdc:mga00v17_195823_c1 | 3300050491 | Bacteria | 1306 |
| 157 | nmdc:mga00v17_9617_c1 | 3300050491 | Bacteria | 5241 |
| 158 | nmdc:mga0yw44_359389_c1 | 3300050492 | Bacteria | 981 |
| 159 | nmdc:mga08y16_335329_c1 | 3300050511 | Unclassified | 1555 |
| 160 | nmdc:mga0sz30_131523_c1 | 3300050516 | Bacteria | 1103 |
| 161 | Ga0495601_0124862 | 3300053077 | Bacteria | 1674 |
| 162 | Ga0500616_0015404 | 3300053153 | Unclassified | 4373 |
| 163 | 2925330435 | 2925326138 | Bacteria | 9652120 |
| 164 | Ga0400490_06605 | |||
| 165 | rootH2_10004307 | |||
| 166 | rootH2_10035337 | |||
| 167 | rootH1_10047319 | |||
| 168 | rootH1_10123037 | |||
| 169 | Ga0070658_10029718 | |||
| 170 | Ga0070683_100606868 | |||
| 171 | Ga0070670_100102552 | |||
| 172 | Ga0070677_10047525 | |||
| 173 | Ga0070660_100022345 | |||
| 174 | Ga0070660_100211180 | |||
| 175 | Ga0070689_100010469 | |||
| 176 | Ga0070689_100177018 | |||
| 177 | Ga0070675_100522349 | |||
| 178 | Ga0070674_100625725 | |||
| 179 | Ga0070713_100270734 | |||
| 180 | Ga0070672_100000111 | |||
| 181 | Ga0068855_100004715 | |||
| 182 | Ga0068857_100267396 | |||
| 183 | Ga0068856_100000089 | |||
| 184 | Ga0068856_100551126 | |||
| 185 | Ga0070702_100104875 | |||
| 186 | Ga0068864_100514214 | |||
| 187 | Ga0068864_100990214 | |||
| 188 | Ga0068860_100031751 | |||
| 189 | Ga0075368_10040086 | |||
| 190 | Ga0075363_100040038 | |||
| 191 | Ga0075363_100088270 | |||
| 192 | Ga0075363_100095906 | |||
| 193 | Ga0075364_10023056 | |||
| 194 | Ga0075364_10095048 | |||
| 195 | Ga0075364_10223087 | |||
| 196 | Ga0075364_10272888 | |||
| 197 | Ga0075362_10077519 | |||
| 198 | Ga0075367_10151273 | |||
| 199 | Ga0075369_10132469 | |||
| 200 | Ga0097621_100141995 | |||
| 201 | Ga0075436_100433176 | |||
| 202 | Ga0105240_10001266 | |||
| 203 | Ga0105240_10118113 | |||
| 204 | Ga0111539_10237113 | |||
| 205 | Ga0105241_10002598 | |||
| 206 | Ga0105242_10976826 | |||
| 207 | Ga0163162_10897227 | |||
| 208 | Ga0157375_10000113 | |||
| 209 | Ga0163163_10001288 | |||
| 210 | Ga0157376_10035393 | |||
| 211 | Ga0213875_10001282 | |||
| 212 | Ga0207682_10028180 | |||
| 213 | Ga0207695_10017840 | |||
| 214 | Ga0207695_10289862 | |||
| 215 | Ga0207657_10307250 | |||
| 216 | Ga0207659_10254535 | |||
| 217 | Ga0207700_10213175 | |||
| 218 | Ga0207670_10136649 | |||
| 219 | Ga0207670_10173343 | |||
| 220 | Ga0207670_10256895 | |||
| 221 | Ga0207704_10222908 | |||
| 222 | Ga0207691_10000500 | |||
| 223 | Ga0207667_10014119 | |||
| 224 | Ga0207702_10036223 | |||
| 225 | Ga0207702_10205913 | |||
| 226 | Ga0207641_10001497 | |||
| 227 | Ga0207641_10428635 | |||
| 228 | Ga0207676_10503178 | |||
| 229 | Ga0207674_10361712 | |||
| 230 | Ga0207674_10502142 | |||
| 231 | Ga0268264_10025439 | |||
| 232 | Ga0265337_1017484 | |||
| 233 | Ga0265326_10004005 | |||
| 234 | Ga0265319_1003824 | |||
| 235 | Ga0265318_10046507 | |||
| 236 | Ga0265338_10000008 | |||
| 237 | Ga0265338_10007353 | |||
| 238 | Ga0265338_10014825 | |||
| 239 | Ga0265338_10028565 | |||
| 240 | Ga0265338_10085830 | |||
| 241 | Ga0265338_10132366 | |||
| 242 | Ga0265327_10004597 | |||
| 243 | Ga0307513_10097897 | |||
| 244 | Ga0316579_10010654 | |||
| 245 | Ga0316576_10168444 | |||
| 246 | Ga0316592_1027982 | |||
| 247 | Ga0316574_0080984 | |||
| 248 | Ga0316574_0186379 | |||
| 249 | Ga0373927_0004366 | |||
| 250 | Ga0373947_0003528 | |||
| 251 | Ga0373925_0002758 | |||
| 252 | Ga0395898_0125769 | |||
| 253 | Ga0436364_0434016 | |||
| 254 | Ga0400484_20244 | |||
| 255 | Ga0400484_33173 | |||
| 256 | Ga0400490_09006 | |||
| 257 | Ga0400490_46894 | |||
| 258 | Ga0400490_55234 | |||
| 259 | Ga0400490_58141 | |||
| 260 | Ga0400491_16491 | |||
| 261 | Ga0400485_14363 | |||
| 262 | Ga0400485_20797 | |||
| 263 | Ga0400488_26924 | |||
| 264 | Ga0400488_35738 | |||
| 265 | Ga0400488_40439 | |||
| 266 | Ga0400486_06093 | |||
| 267 | Ga0400486_20466 | |||
| 268 | Ga0400486_22667 | |||
| 269 | Ga0400483_060986 | |||
| 270 | Ga0400483_071935 | |||
| 271 | Ga0400483_159233 | |||
| 272 | Ga0400483_249988 | |||
| 273 | Ga0400489_03161 | |||
| 274 | Ga0400489_46726 | |||
| 275 | Ga0400487_55931 | |||
| 276 | Ga0451577_0006964 | |||
| 277 | Ga0451577_0008790 | |||
| 278 | Ga0451577_0021282 | |||
| 279 | Ga0451577_0072432 | |||
| 280 | Ga0451577_0083320 | |||
| 281 | Ga0451577_0207924 | |||
| 282 | Ga0466972_0030573 | |||
| 283 | Ga0453683_0000379 | |||
| 284 | Ga0453683_0004562 | |||
| 285 | Ga0466965_0031599 | |||
| 286 | Ga0453684_0000942 | |||
| 287 | Ga0453684_0009041 | |||
| 288 | Ga0453684_0014757 | |||
| 289 | Ga0453684_0029663 | |||
| 290 | Ga0453684_0034481 | |||
| 291 | Ga0453684_0050520 | |||
| 292 | Ga0466960_0012243 | |||
| 293 | Ga0451576_0011952 | |||
| 294 | Ga0495592_0000081 | |||
| 295 | Ga0495662_0028962 | |||
| 296 | Ga0495628_0001865 | |||
| 297 | Ga0495630_0029698 | |||
| 298 | Ga0495640_0007601 | |||
| 299 | Ga0495586_0000421 | |||
| 300 | Ga0495645_0327226 | |||
| 301 | Ga0495667_0338589 | |||
| 302 | Ga0495674_0327353 | |||
| 303 | Ga0495676_0053077 | |||
| 304 | Ga0501073_0008135 | |||
| 305 | Ga0501075_0400786 | |||
| 306 | Ga0501076_0103142 | |||
| 307 | Ga0501080_0034253 | |||
| 308 | Ga0501080_0108512 | |||
| 309 | Ga0501083_0002189 | |||
| 310 | Ga0501083_0012677 | |||
| 311 | Ga0501035_0072711 | |||
| 312 | Ga0501044_0520575 | |||
| 313 | nmdc:mga03683_82995_c1 | |||
| 314 | nmdc:mga03n38_38621_c1 | |||
| 315 | nmdc:mga03n38_44783_c1 | |||
| 316 | nmdc:mga00v17_13243_c1 | |||
| 317 | nmdc:mga00v17_173528_c1 | |||
| 318 | nmdc:mga00v17_181573_c1 | |||
| 319 | nmdc:mga00v17_195823_c1 | |||
| 320 | nmdc:mga00v17_9617_c1 | |||
| 321 | nmdc:mga0yw44_359389_c1 | |||
| 322 | nmdc:mga08y16_335329_c1 | |||
| 323 | nmdc:mga0sz30_131523_c1 | |||
| 324 | Ga0495601_0124862 | |||
| 325 | Ga0500616_0015404 | |||
| 326 | 2925330435 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2agk-assembly1.cif.gz_A | structure of s. cerevisiae his6 protein | 0.9464 | 2 | 251 |
| 2agk-assembly1.cif.gz_A | structure of s. cerevisiae his6 protein | 0.9345 | 2 | 251 |
| 3tdm-assembly2.cif.gz_C | computationally designed tim-barrel protein, halfflr | 0.9029 | 127 | 229 |
| 3tdn-assembly1.cif.gz_A | computationally designed two-fold symmetric tim-barrel protein, flr | 0.897 | 127 | 229 |
| 2y88-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis phosphoribosyl isomerase (variant d11n) with bound prfar | 0.8518 | 1 | 229 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O82782_44_301_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9784 | 2 | 251 | 3.20.20.70 |
| af_O82782_44_301_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9669 | 2 | 251 | 3.20.20.70 |
| af_A0A1D8PMD0_2_276_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9543 | 2 | 251 | 3.20.20.70 |
| 2agkA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9464 | 2 | 251 | 3.20.20.70 |
| af_A0A1D8PMD0_2_276_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9432 | 2 | 251 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6F2B4-F1-model_v4 | 5-proFAR isomerase (Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase) | 0.9946 | 33 | 248 |
GO:0000105
GO:0000162 GO:0003949 GO:0005737 |
| AF-A0A357TDZ5-F1-model_v4 | Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase | 0.9941 | 94 | 250 |
GO:0000105
GO:0000162 GO:0003949 GO:0005737 |
| AF-A0A355SY00-F1-model_v4 | Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase | 0.9931 | 121 | 248 |
GO:0000105
GO:0000162 GO:0003949 GO:0005737 |
| AF-A0A6N6Q3F0-F1-model_v4 | 5-proFAR isomerase (Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase) | 0.9924 | 77 | 249 |
GO:0000105
GO:0000162 GO:0003949 GO:0005737 |
| AF-A0A2S4VXY3-F1-model_v4 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (EC 5.3.1.16) (5-proFAR isomerase) (Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase) | 0.9904 | 80 | 251 |
GO:0000105
GO:0000162 GO:0003949 GO:0005737 |