F242038
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 163 | 116 | 326 | 343 |
Family's Representative Sequence
| Representative Sequence | 3300035242|Ga0373962_0072016|Ga0373962_0072016_55_1008 |
| Length | 317 |
| Sequence | MDGRVLDAPYPIRFCVVYFAILPSRPKQSAEAYEKVWLPEGSPLVVTSQKVQAELQRRVSVPVELAMRYQNPSIESAIKELHKQGVEELLIVPMFPHYAMSSYETAVERVKHVAARKAPRMALCVVPPYYNHRDYIDALVASATEYLSQDYDHLLFSFHGLPERHLRKSDPTCSHCLRVENCCTISGAAHQTCYRAQCFKTVDAFVKKADVVRYSVAFQSRLGREPWLQPYTDQELIRLARDGIKKLLVICPAFVSDCLETLEEMGLRGRDTFLEAGGKQFTLIPCLNEHPAWIDALEKMVSQFCGNRQPAVVSCQT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 15 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 16 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 17 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 18 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 19 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 20 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 21 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 22 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 23 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 24 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 25 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 31 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 32 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 55 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 56 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 57 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 58 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 59 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 60 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 61 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 62 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 63 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 64 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 65 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 66 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 67 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 68 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 69 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 70 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 71 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 72 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 73 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 74 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 75 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 76 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 103 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 104 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 105 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 106 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 107 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 108 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 109 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 110 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 111 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 112 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 113 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 114 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.61 |
| Nodule | 0 |
| Rhizoplane | 4.29 |
| Rhizosphere | 95.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.95 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373962_0072016 | 3300035242 | Bacteria | 1035 |
| 2 | Ga0065707_10104382 | 3300005295 | Unclassified | 2698 |
| 3 | Ga0070670_100127976 | 3300005331 | Bacteria | 2192 |
| 4 | Ga0070666_10037579 | 3300005335 | Bacteria | 3220 |
| 5 | Ga0070660_100139222 | 3300005339 | Bacteria | 1946 |
| 6 | Ga0070668_100241539 | 3300005347 | Bacteria | 1496 |
| 7 | Ga0070675_100179496 | 3300005354 | Unclassified | 1830 |
| 8 | Ga0070667_100120290 | 3300005367 | Bacteria | 2284 |
| 9 | Ga0070714_100024100 | 3300005435 | Bacteria | 5007 |
| 10 | Ga0070711_100242499 | 3300005439 | Bacteria | 1410 |
| 11 | Ga0070681_10089025 | 3300005458 | Unclassified | 3038 |
| 12 | Ga0070685_10178020 | 3300005466 | Bacteria | 1367 |
| 13 | Ga0070679_100056517 | 3300005530 | Bacteria | 3910 |
| 14 | Ga0068853_100061627 | 3300005539 | Unclassified | 3245 |
| 15 | Ga0068855_100033400 | 3300005563 | Bacteria | 6141 |
| 16 | Ga0068856_100154031 | 3300005614 | Bacteria | 2308 |
| 17 | Ga0068864_100041995 | 3300005618 | Unclassified | 3912 |
| 18 | Ga0068863_100155068 | 3300005841 | Bacteria | 2192 |
| 19 | Ga0068863_100308694 | 3300005841 | Unclassified | 1535 |
| 20 | Ga0075436_100060011 | 3300006914 | Bacteria | 2627 |
| 21 | Ga0099795_10051647 | 3300007788 | Unclassified | 1499 |
| 22 | Ga0105240_10001894 | 3300009093 | Bacteria | 34718 |
| 23 | Ga0105240_10038985 | 3300009093 | Bacteria | 6089 |
| 24 | Ga0105240_10049077 | 3300009093 | Bacteria | 5331 |
| 25 | Ga0105240_10632028 | 3300009093 | Unclassified | 1175 |
| 26 | Ga0111539_10034661 | 3300009094 | Bacteria | 6116 |
| 27 | Ga0105245_10066586 | 3300009098 | Unclassified | 3261 |
| 28 | Ga0105245_10355155 | 3300009098 | Bacteria | 1453 |
| 29 | Ga0105243_10172838 | 3300009148 | Bacteria | 1873 |
| 30 | Ga0105242_10024829 | 3300009176 | Bacteria | 4737 |
| 31 | Ga0105248_10026477 | 3300009177 | Bacteria | 6453 |
| 32 | Ga0105238_10011717 | 3300009551 | Bacteria | 8839 |
| 33 | Ga0105249_10413621 | 3300009553 | Bacteria | 1381 |
| 34 | Ga0105239_10057812 | 3300010375 | Bacteria | 4255 |
| 35 | Ga0157370_10067472 | 3300013104 | Unclassified | 3381 |
| 36 | Ga0157370_10097332 | 3300013104 | Bacteria | 2760 |
| 37 | Ga0157374_10165964 | 3300013296 | Bacteria | 2152 |
| 38 | Ga0157374_10175213 | 3300013296 | Bacteria | 2093 |
| 39 | Ga0157378_10091751 | 3300013297 | Unclassified | 2762 |
| 40 | Ga0163162_10179517 | 3300013306 | Bacteria | 2243 |
| 41 | Ga0157375_10000027 | 3300013308 | Bacteria | 220909 |
| 42 | Ga0157375_10016227 | 3300013308 | Bacteria | 6682 |
| 43 | Ga0163163_10003791 | 3300014325 | Bacteria | 12876 |
| 44 | Ga0163163_10058150 | 3300014325 | Bacteria | 3823 |
| 45 | Ga0157376_10214988 | 3300014969 | Unclassified | 1777 |
| 46 | Ga0163161_10054671 | 3300017792 | Bacteria | 2898 |
| 47 | Ga0207680_10010663 | 3300025903 | Unclassified | 4608 |
| 48 | Ga0207645_10050169 | 3300025907 | Bacteria | 2664 |
| 49 | Ga0207707_10044308 | 3300025912 | Bacteria | 3879 |
| 50 | Ga0207707_10141447 | 3300025912 | Bacteria | 2104 |
| 51 | Ga0207695_10019289 | 3300025913 | Bacteria | 7853 |
| 52 | Ga0207695_10076224 | 3300025913 | Unclassified | 3410 |
| 53 | Ga0207663_10175433 | 3300025916 | Bacteria | 1526 |
| 54 | Ga0207652_10271103 | 3300025921 | Bacteria | 1531 |
| 55 | Ga0207694_10078167 | 3300025924 | Bacteria | 2593 |
| 56 | Ga0207650_10140906 | 3300025925 | Bacteria | 1895 |
| 57 | Ga0207687_10101880 | 3300025927 | Unclassified | 2114 |
| 58 | Ga0207664_10020307 | 3300025929 | Unclassified | 4921 |
| 59 | Ga0207711_10057002 | 3300025941 | Bacteria | 3358 |
| 60 | Ga0207667_10020005 | 3300025949 | Bacteria | 7456 |
| 61 | Ga0207667_10175172 | 3300025949 | Bacteria | 2204 |
| 62 | Ga0207641_10477735 | 3300026088 | Bacteria | 1208 |
| 63 | Ga0207648_10123016 | 3300026089 | Bacteria | 2282 |
| 64 | Ga0207676_10049645 | 3300026095 | Bacteria | 3266 |
| 65 | Ga0268266_10089771 | 3300028379 | Bacteria | 2692 |
| 66 | Ga0265337_1002847 | 3300028556 | Bacteria | 7724 |
| 67 | Ga0265337_1007762 | 3300028556 | Bacteria | 3979 |
| 68 | Ga0265326_10022006 | 3300028558 | Bacteria | 1827 |
| 69 | Ga0265319_1000001 | 3300028563 | Bacteria | 549513 |
| 70 | Ga0265338_10002229 | 3300028800 | Bacteria | 29539 |
| 71 | Ga0265338_10003980 | 3300028800 | Bacteria | 20337 |
| 72 | Ga0265338_10007727 | 3300028800 | Bacteria | 13233 |
| 73 | Ga0265338_10029107 | 3300028800 | Bacteria | 5488 |
| 74 | Ga0265320_10028122 | 3300031240 | Unclassified | 2922 |
| 75 | Ga0265329_10001177 | 3300031242 | Bacteria | 12863 |
| 76 | Ga0265340_10002122 | 3300031247 | Bacteria | 11358 |
| 77 | Ga0265340_10005183 | 3300031247 | Bacteria | 7244 |
| 78 | Ga0265340_10012148 | 3300031247 | Bacteria | 4551 |
| 79 | Ga0265327_10000581 | 3300031251 | Bacteria | 61702 |
| 80 | Ga0307408_100145545 | 3300031548 | Bacteria | 1865 |
| 81 | Ga0265313_10004898 | 3300031595 | Bacteria | 10035 |
| 82 | Ga0265314_10000046 | 3300031711 | Bacteria | 199789 |
| 83 | Ga0307411_10066645 | 3300032005 | Bacteria | 2420 |
| 84 | Ga0373953_0010030 | 3300035117 | Bacteria | 3284 |
| 85 | Ga0373954_0018959 | 3300035118 | Bacteria | 3101 |
| 86 | Ga0373927_0011926 | 3300035695 | Bacteria | 5785 |
| 87 | Ga0373937_0002253 | 3300036401 | Bacteria | 16092 |
| 88 | Ga0373937_0077992 | 3300036401 | Unclassified | 3061 |
| 89 | Ga0316584_0050263 | 3300036712 | Bacteria | 3117 |
| 90 | Ga0373925_0004773 | 3300037068 | Bacteria | 10207 |
| 91 | Ga0373925_0010716 | 3300037068 | Bacteria | 6649 |
| 92 | Ga0373925_0099092 | 3300037068 | Bacteria | 2238 |
| 93 | Ga0373925_0382114 | 3300037068 | Bacteria | 1147 |
| 94 | Ga0439464_0016431 | 3300042439 | Bacteria | 2001 |
| 95 | Ga0451577_0002579 | 3300042876 | Bacteria | 21385 |
| 96 | Ga0451577_0013290 | 3300042876 | Bacteria | 7712 |
| 97 | Ga0453684_0013359 | 3300044712 | Bacteria | 13351 |
| 98 | Ga0453684_0016394 | 3300044712 | Bacteria | 11589 |
| 99 | Ga0453684_0020287 | 3300044712 | Bacteria | 10038 |
| 100 | Ga0453684_0324437 | 3300044712 | Unclassified | 1743 |
| 101 | Ga0451576_0282668 | 3300045051 | Unclassified | 1735 |
| 102 | Ga0495592_0019820 | 3300046454 | Bacteria | 5114 |
| 103 | Ga0495592_0090614 | 3300046454 | Bacteria | 2194 |
| 104 | Ga0495641_0018643 | 3300046461 | Bacteria | 3576 |
| 105 | Ga0495641_0061746 | 3300046461 | Bacteria | 1691 |
| 106 | Ga0495582_0014213 | 3300046473 | Bacteria | 4378 |
| 107 | Ga0495582_0196910 | 3300046473 | Unclassified | 1150 |
| 108 | Ga0495639_0011494 | 3300046475 | Bacteria | 3818 |
| 109 | Ga0495662_0026814 | 3300046476 | Unclassified | 2783 |
| 110 | Ga0495608_0063593 | 3300046511 | Bacteria | 2421 |
| 111 | Ga0495630_0000043 | 3300046517 | Bacteria | 104062 |
| 112 | Ga0495630_0052857 | 3300046517 | Bacteria | 3041 |
| 113 | Ga0495630_0073473 | 3300046517 | Bacteria | 2575 |
| 114 | Ga0495630_0102915 | 3300046517 | Bacteria | 2161 |
| 115 | Ga0495630_0330795 | 3300046517 | Unclassified | 1165 |
| 116 | Ga0495666_0010831 | 3300046526 | Bacteria | 4547 |
| 117 | Ga0495640_0024368 | 3300046533 | Unclassified | 4403 |
| 118 | Ga0495640_0038423 | 3300046533 | Bacteria | 3367 |
| 119 | Ga0495586_0000763 | 3300046535 | Bacteria | 18505 |
| 120 | Ga0495586_0000878 | 3300046535 | Bacteria | 17220 |
| 121 | Ga0495586_0001087 | 3300046535 | Bacteria | 15369 |
| 122 | Ga0495645_0107448 | 3300046543 | Unclassified | 1978 |
| 123 | Ga0495645_0165386 | 3300046543 | Bacteria | 1526 |
| 124 | Ga0495667_0077430 | 3300046559 | Bacteria | 2163 |
| 125 | Ga0495634_0018601 | 3300046642 | Bacteria | 4943 |
| 126 | Ga0495634_0048797 | 3300046642 | Bacteria | 2848 |
| 127 | Ga0495635_0194492 | 3300046663 | Bacteria | 1377 |
| 128 | Ga0495599_0044342 | 3300046678 | Bacteria | 2789 |
| 129 | Ga0495599_0145484 | 3300046678 | Bacteria | 1469 |
| 130 | Ga0495647_0004828 | 3300046681 | Bacteria | 4404 |
| 131 | Ga0495647_0058515 | 3300046681 | Bacteria | 1515 |
| 132 | Ga0495658_0003876 | 3300046683 | Bacteria | 7402 |
| 133 | Ga0495658_0089219 | 3300046683 | Bacteria | 1824 |
| 134 | Ga0495613_0000995 | 3300046689 | Bacteria | 21526 |
| 135 | Ga0495613_0003056 | 3300046689 | Bacteria | 12505 |
| 136 | Ga0495624_0043775 | 3300046690 | Bacteria | 2855 |
| 137 | Ga0495624_0111340 | 3300046690 | Bacteria | 1683 |
| 138 | Ga0495600_0098028 | 3300046809 | Bacteria | 1911 |
| 139 | Ga0495581_0149476 | 3300047315 | Bacteria | 1364 |
| 140 | Ga0495604_0269257 | 3300047317 | Bacteria | 1155 |
| 141 | Ga0495674_0000046 | 3300047319 | Bacteria | 81912 |
| 142 | Ga0495676_0201939 | 3300047321 | Bacteria | 1381 |
| 143 | Ga0495680_0101569 | 3300047322 | Bacteria | 2142 |
| 144 | Ga0495684_0139492 | 3300047471 | Bacteria | 1818 |
| 145 | Ga0495684_0326440 | 3300047471 | Unclassified | 1096 |
| 146 | Ga0496101_0115121 | 3300048904 | Bacteria | 2028 |
| 147 | Ga0496104_0008633 | 3300048907 | Bacteria | 9064 |
| 148 | Ga0496105_0021584 | 3300048908 | Bacteria | 5212 |
| 149 | Ga0496110_0457854 | 3300048913 | Bacteria | 1162 |
| 150 | Ga0496114_0003029 | 3300048917 | Bacteria | 12885 |
| 151 | Ga0496114_0190671 | 3300048917 | Bacteria | 1793 |
| 152 | Ga0496115_0005285 | 3300048918 | Bacteria | 9390 |
| 153 | Ga0501033_0013357 | 3300049570 | Bacteria | 6257 |
| 154 | Ga0501033_0016206 | 3300049570 | Bacteria | 5644 |
| 155 | Ga0501034_0135993 | 3300049571 | Bacteria | 2439 |
| 156 | Ga0501037_0047184 | 3300049573 | Bacteria | 3158 |
| 157 | Ga0501043_0074034 | 3300049579 | Bacteria | 2675 |
| 158 | Ga0501043_0135505 | 3300049579 | Bacteria | 1929 |
| 159 | Ga0501047_0283534 | 3300049581 | Bacteria | 1501 |
| 160 | Ga0501035_0247858 | 3300049822 | Bacteria | 1513 |
| 161 | Ga0495601_0127579 | 3300053077 | Bacteria | 1655 |
| 162 | Ga0495595_0010702 | 3300053084 | Bacteria | 3820 |
| 163 | Ga0500650_0011264 | 3300053098 | Bacteria | 3675 |
| 164 | Ga0373962_0072016 | |||
| 165 | Ga0065707_10104382 | |||
| 166 | Ga0070670_100127976 | |||
| 167 | Ga0070666_10037579 | |||
| 168 | Ga0070660_100139222 | |||
| 169 | Ga0070668_100241539 | |||
| 170 | Ga0070675_100179496 | |||
| 171 | Ga0070667_100120290 | |||
| 172 | Ga0070714_100024100 | |||
| 173 | Ga0070711_100242499 | |||
| 174 | Ga0070681_10089025 | |||
| 175 | Ga0070685_10178020 | |||
| 176 | Ga0070679_100056517 | |||
| 177 | Ga0068853_100061627 | |||
| 178 | Ga0068855_100033400 | |||
| 179 | Ga0068856_100154031 | |||
| 180 | Ga0068864_100041995 | |||
| 181 | Ga0068863_100155068 | |||
| 182 | Ga0068863_100308694 | |||
| 183 | Ga0075436_100060011 | |||
| 184 | Ga0099795_10051647 | |||
| 185 | Ga0105240_10001894 | |||
| 186 | Ga0105240_10038985 | |||
| 187 | Ga0105240_10049077 | |||
| 188 | Ga0105240_10632028 | |||
| 189 | Ga0111539_10034661 | |||
| 190 | Ga0105245_10066586 | |||
| 191 | Ga0105245_10355155 | |||
| 192 | Ga0105243_10172838 | |||
| 193 | Ga0105242_10024829 | |||
| 194 | Ga0105248_10026477 | |||
| 195 | Ga0105238_10011717 | |||
| 196 | Ga0105249_10413621 | |||
| 197 | Ga0105239_10057812 | |||
| 198 | Ga0157370_10067472 | |||
| 199 | Ga0157370_10097332 | |||
| 200 | Ga0157374_10165964 | |||
| 201 | Ga0157374_10175213 | |||
| 202 | Ga0157378_10091751 | |||
| 203 | Ga0163162_10179517 | |||
| 204 | Ga0157375_10000027 | |||
| 205 | Ga0157375_10016227 | |||
| 206 | Ga0163163_10003791 | |||
| 207 | Ga0163163_10058150 | |||
| 208 | Ga0157376_10214988 | |||
| 209 | Ga0163161_10054671 | |||
| 210 | Ga0207680_10010663 | |||
| 211 | Ga0207645_10050169 | |||
| 212 | Ga0207707_10044308 | |||
| 213 | Ga0207707_10141447 | |||
| 214 | Ga0207695_10019289 | |||
| 215 | Ga0207695_10076224 | |||
| 216 | Ga0207663_10175433 | |||
| 217 | Ga0207652_10271103 | |||
| 218 | Ga0207694_10078167 | |||
| 219 | Ga0207650_10140906 | |||
| 220 | Ga0207687_10101880 | |||
| 221 | Ga0207664_10020307 | |||
| 222 | Ga0207711_10057002 | |||
| 223 | Ga0207667_10020005 | |||
| 224 | Ga0207667_10175172 | |||
| 225 | Ga0207641_10477735 | |||
| 226 | Ga0207648_10123016 | |||
| 227 | Ga0207676_10049645 | |||
| 228 | Ga0268266_10089771 | |||
| 229 | Ga0265337_1002847 | |||
| 230 | Ga0265337_1007762 | |||
| 231 | Ga0265326_10022006 | |||
| 232 | Ga0265319_1000001 | |||
| 233 | Ga0265338_10002229 | |||
| 234 | Ga0265338_10003980 | |||
| 235 | Ga0265338_10007727 | |||
| 236 | Ga0265338_10029107 | |||
| 237 | Ga0265320_10028122 | |||
| 238 | Ga0265329_10001177 | |||
| 239 | Ga0265340_10002122 | |||
| 240 | Ga0265340_10005183 | |||
| 241 | Ga0265340_10012148 | |||
| 242 | Ga0265327_10000581 | |||
| 243 | Ga0307408_100145545 | |||
| 244 | Ga0265313_10004898 | |||
| 245 | Ga0265314_10000046 | |||
| 246 | Ga0307411_10066645 | |||
| 247 | Ga0373953_0010030 | |||
| 248 | Ga0373954_0018959 | |||
| 249 | Ga0373927_0011926 | |||
| 250 | Ga0373937_0002253 | |||
| 251 | Ga0373937_0077992 | |||
| 252 | Ga0316584_0050263 | |||
| 253 | Ga0373925_0004773 | |||
| 254 | Ga0373925_0010716 | |||
| 255 | Ga0373925_0099092 | |||
| 256 | Ga0373925_0382114 | |||
| 257 | Ga0439464_0016431 | |||
| 258 | Ga0451577_0002579 | |||
| 259 | Ga0451577_0013290 | |||
| 260 | Ga0453684_0013359 | |||
| 261 | Ga0453684_0016394 | |||
| 262 | Ga0453684_0020287 | |||
| 263 | Ga0453684_0324437 | |||
| 264 | Ga0451576_0282668 | |||
| 265 | Ga0495592_0019820 | |||
| 266 | Ga0495592_0090614 | |||
| 267 | Ga0495641_0018643 | |||
| 268 | Ga0495641_0061746 | |||
| 269 | Ga0495582_0014213 | |||
| 270 | Ga0495582_0196910 | |||
| 271 | Ga0495639_0011494 | |||
| 272 | Ga0495662_0026814 | |||
| 273 | Ga0495608_0063593 | |||
| 274 | Ga0495630_0000043 | |||
| 275 | Ga0495630_0052857 | |||
| 276 | Ga0495630_0073473 | |||
| 277 | Ga0495630_0102915 | |||
| 278 | Ga0495630_0330795 | |||
| 279 | Ga0495666_0010831 | |||
| 280 | Ga0495640_0024368 | |||
| 281 | Ga0495640_0038423 | |||
| 282 | Ga0495586_0000763 | |||
| 283 | Ga0495586_0000878 | |||
| 284 | Ga0495586_0001087 | |||
| 285 | Ga0495645_0107448 | |||
| 286 | Ga0495645_0165386 | |||
| 287 | Ga0495667_0077430 | |||
| 288 | Ga0495634_0018601 | |||
| 289 | Ga0495634_0048797 | |||
| 290 | Ga0495635_0194492 | |||
| 291 | Ga0495599_0044342 | |||
| 292 | Ga0495599_0145484 | |||
| 293 | Ga0495647_0004828 | |||
| 294 | Ga0495647_0058515 | |||
| 295 | Ga0495658_0003876 | |||
| 296 | Ga0495658_0089219 | |||
| 297 | Ga0495613_0000995 | |||
| 298 | Ga0495613_0003056 | |||
| 299 | Ga0495624_0043775 | |||
| 300 | Ga0495624_0111340 | |||
| 301 | Ga0495600_0098028 | |||
| 302 | Ga0495581_0149476 | |||
| 303 | Ga0495604_0269257 | |||
| 304 | Ga0495674_0000046 | |||
| 305 | Ga0495676_0201939 | |||
| 306 | Ga0495680_0101569 | |||
| 307 | Ga0495684_0139492 | |||
| 308 | Ga0495684_0326440 | |||
| 309 | Ga0496101_0115121 | |||
| 310 | Ga0496104_0008633 | |||
| 311 | Ga0496105_0021584 | |||
| 312 | Ga0496110_0457854 | |||
| 313 | Ga0496114_0003029 | |||
| 314 | Ga0496114_0190671 | |||
| 315 | Ga0496115_0005285 | |||
| 316 | Ga0501033_0013357 | |||
| 317 | Ga0501033_0016206 | |||
| 318 | Ga0501034_0135993 | |||
| 319 | Ga0501037_0047184 | |||
| 320 | Ga0501043_0074034 | |||
| 321 | Ga0501043_0135505 | |||
| 322 | Ga0501047_0283534 | |||
| 323 | Ga0501035_0247858 | |||
| 324 | Ga0495601_0127579 | |||
| 325 | Ga0495595_0010702 | |||
| 326 | Ga0500650_0011264 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2pnj-assembly1.cif.gz_A | crystal structure of human ferrochelatase mutant with phe 337 replaced by ala | 0.8725 | 2 | 339 |
| 2hre-assembly1.cif.gz_A | structure of human ferrochelatase variant e343k with protoporphyrin ix bound | 0.8634 | 2 | 339 |
| 4klc-assembly1.cif.gz_B | e343d/f110a double mutant of human ferrochelatase | 0.8563 | 2 | 339 |
| 3aqi-assembly1.cif.gz_B | h240a variant of human ferrochelatase | 0.851 | 2 | 339 |
| 4kmm-assembly1.cif.gz_B | m76h variant of human ferrochelatase | 0.8505 | 2 | 339 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P23871_6_161_3.40.50.1400 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9628 | 5 | 156 | 3.40.50.1400 |
| af_P23871_6_250_3.40.605.10 | Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 | 0.9493 | 5 | 266 | 3.40.605.10 |
| af_P23871_188_298_3.40.50.1400 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9448 | 184 | 314 | 3.40.50.1400 |
| af_P23871_6_250_3.40.605.10 | Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 | 0.938 | 5 | 266 | 3.40.605.10 |
| af_P23871_6_161_3.40.50.1400 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.933 | 5 | 156 | 3.40.50.1400 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3N9NYZ3-F1-model_v4 | Ferrochelatase (EC 4.98.1.1) (Heme synthase) (Protoheme ferro-lyase) | 0.9944 | 1 | 331 |
GO:0004325
GO:0005737 GO:0006783 GO:0046872 |
| AF-A0A383CEG3-F1-model_v4 | Ferrochelatase | 0.9928 | 9 | 183 |
GO:0004325
GO:0006783 |
| AF-A0A7C3WFC2-F1-model_v4 | Ferrochelatase (EC 4.99.1.1) | 0.9923 | 1 | 238 |
GO:0004325
GO:0006783 |
| AF-A0A800IK26-F1-model_v4 | Ferrochelatase (EC 4.98.1.1) (Heme synthase) (Protoheme ferro-lyase) | 0.9892 | 1 | 335 |
GO:0004325
GO:0005737 GO:0006783 GO:0046872 |
| AF-A0A1G7W3V4-F1-model_v4 | Ferrochelatase (EC 4.98.1.1) (Heme synthase) (Protoheme ferro-lyase) | 0.9873 | 2 | 336 |
GO:0004325
GO:0005737 GO:0006783 GO:0046872 |