F242038

General Info

Members Datasets Scaffolds Average Seq Length
163 116 326 343

Family's Representative Sequence

Representative Sequence 3300035242|Ga0373962_0072016|Ga0373962_0072016_55_1008
Length 317
Sequence MDGRVLDAPYPIRFCVVYFAILPSRPKQSAEAYEKVWLPEGSPLVVTSQKVQAELQRRVSVPVELAMRYQNPSIESAIKELHKQGVEELLIVPMFPHYAMSSYETAVERVKHVAARKAPRMALCVVPPYYNHRDYIDALVASATEYLSQDYDHLLFSFHGLPERHLRKSDPTCSHCLRVENCCTISGAAHQTCYRAQCFKTVDAFVKKADVVRYSVAFQSRLGREPWLQPYTDQELIRLARDGIKKLLVICPAFVSDCLETLEEMGLRGRDTFLEAGGKQFTLIPCLNEHPAWIDALEKMVSQFCGNRQPAVVSCQT

Samples

Sample ID Description Type Environment
1 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
20 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
25 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
26 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
32 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
33 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
38 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
55 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
56 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
57 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
58 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
59 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
60 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
61 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
62 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
63 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
64 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
65 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
66 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
67 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
68 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
69 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
70 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
71 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
72 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
73 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
74 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
75 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
76 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
77 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
78 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
79 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
80 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
81 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
82 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
83 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
84 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
85 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
86 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
87 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
88 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
89 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
90 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
91 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
92 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
93 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
94 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
95 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
96 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
97 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
98 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
99 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
100 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
101 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
102 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
103 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
104 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
105 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
106 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
107 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
108 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
114 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
115 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
116 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.61
Nodule 0
Rhizoplane 4.29
Rhizosphere 95.09
Stem 0
Stem Tuber 0
Unclassified 15.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373962_0072016 3300035242 Bacteria 1035
2 Ga0065707_10104382 3300005295 Unclassified 2698
3 Ga0070670_100127976 3300005331 Bacteria 2192
4 Ga0070666_10037579 3300005335 Bacteria 3220
5 Ga0070660_100139222 3300005339 Bacteria 1946
6 Ga0070668_100241539 3300005347 Bacteria 1496
7 Ga0070675_100179496 3300005354 Unclassified 1830
8 Ga0070667_100120290 3300005367 Bacteria 2284
9 Ga0070714_100024100 3300005435 Bacteria 5007
10 Ga0070711_100242499 3300005439 Bacteria 1410
11 Ga0070681_10089025 3300005458 Unclassified 3038
12 Ga0070685_10178020 3300005466 Bacteria 1367
13 Ga0070679_100056517 3300005530 Bacteria 3910
14 Ga0068853_100061627 3300005539 Unclassified 3245
15 Ga0068855_100033400 3300005563 Bacteria 6141
16 Ga0068856_100154031 3300005614 Bacteria 2308
17 Ga0068864_100041995 3300005618 Unclassified 3912
18 Ga0068863_100155068 3300005841 Bacteria 2192
19 Ga0068863_100308694 3300005841 Unclassified 1535
20 Ga0075436_100060011 3300006914 Bacteria 2627
21 Ga0099795_10051647 3300007788 Unclassified 1499
22 Ga0105240_10001894 3300009093 Bacteria 34718
23 Ga0105240_10038985 3300009093 Bacteria 6089
24 Ga0105240_10049077 3300009093 Bacteria 5331
25 Ga0105240_10632028 3300009093 Unclassified 1175
26 Ga0111539_10034661 3300009094 Bacteria 6116
27 Ga0105245_10066586 3300009098 Unclassified 3261
28 Ga0105245_10355155 3300009098 Bacteria 1453
29 Ga0105243_10172838 3300009148 Bacteria 1873
30 Ga0105242_10024829 3300009176 Bacteria 4737
31 Ga0105248_10026477 3300009177 Bacteria 6453
32 Ga0105238_10011717 3300009551 Bacteria 8839
33 Ga0105249_10413621 3300009553 Bacteria 1381
34 Ga0105239_10057812 3300010375 Bacteria 4255
35 Ga0157370_10067472 3300013104 Unclassified 3381
36 Ga0157370_10097332 3300013104 Bacteria 2760
37 Ga0157374_10165964 3300013296 Bacteria 2152
38 Ga0157374_10175213 3300013296 Bacteria 2093
39 Ga0157378_10091751 3300013297 Unclassified 2762
40 Ga0163162_10179517 3300013306 Bacteria 2243
41 Ga0157375_10000027 3300013308 Bacteria 220909
42 Ga0157375_10016227 3300013308 Bacteria 6682
43 Ga0163163_10003791 3300014325 Bacteria 12876
44 Ga0163163_10058150 3300014325 Bacteria 3823
45 Ga0157376_10214988 3300014969 Unclassified 1777
46 Ga0163161_10054671 3300017792 Bacteria 2898
47 Ga0207680_10010663 3300025903 Unclassified 4608
48 Ga0207645_10050169 3300025907 Bacteria 2664
49 Ga0207707_10044308 3300025912 Bacteria 3879
50 Ga0207707_10141447 3300025912 Bacteria 2104
51 Ga0207695_10019289 3300025913 Bacteria 7853
52 Ga0207695_10076224 3300025913 Unclassified 3410
53 Ga0207663_10175433 3300025916 Bacteria 1526
54 Ga0207652_10271103 3300025921 Bacteria 1531
55 Ga0207694_10078167 3300025924 Bacteria 2593
56 Ga0207650_10140906 3300025925 Bacteria 1895
57 Ga0207687_10101880 3300025927 Unclassified 2114
58 Ga0207664_10020307 3300025929 Unclassified 4921
59 Ga0207711_10057002 3300025941 Bacteria 3358
60 Ga0207667_10020005 3300025949 Bacteria 7456
61 Ga0207667_10175172 3300025949 Bacteria 2204
62 Ga0207641_10477735 3300026088 Bacteria 1208
63 Ga0207648_10123016 3300026089 Bacteria 2282
64 Ga0207676_10049645 3300026095 Bacteria 3266
65 Ga0268266_10089771 3300028379 Bacteria 2692
66 Ga0265337_1002847 3300028556 Bacteria 7724
67 Ga0265337_1007762 3300028556 Bacteria 3979
68 Ga0265326_10022006 3300028558 Bacteria 1827
69 Ga0265319_1000001 3300028563 Bacteria 549513
70 Ga0265338_10002229 3300028800 Bacteria 29539
71 Ga0265338_10003980 3300028800 Bacteria 20337
72 Ga0265338_10007727 3300028800 Bacteria 13233
73 Ga0265338_10029107 3300028800 Bacteria 5488
74 Ga0265320_10028122 3300031240 Unclassified 2922
75 Ga0265329_10001177 3300031242 Bacteria 12863
76 Ga0265340_10002122 3300031247 Bacteria 11358
77 Ga0265340_10005183 3300031247 Bacteria 7244
78 Ga0265340_10012148 3300031247 Bacteria 4551
79 Ga0265327_10000581 3300031251 Bacteria 61702
80 Ga0307408_100145545 3300031548 Bacteria 1865
81 Ga0265313_10004898 3300031595 Bacteria 10035
82 Ga0265314_10000046 3300031711 Bacteria 199789
83 Ga0307411_10066645 3300032005 Bacteria 2420
84 Ga0373953_0010030 3300035117 Bacteria 3284
85 Ga0373954_0018959 3300035118 Bacteria 3101
86 Ga0373927_0011926 3300035695 Bacteria 5785
87 Ga0373937_0002253 3300036401 Bacteria 16092
88 Ga0373937_0077992 3300036401 Unclassified 3061
89 Ga0316584_0050263 3300036712 Bacteria 3117
90 Ga0373925_0004773 3300037068 Bacteria 10207
91 Ga0373925_0010716 3300037068 Bacteria 6649
92 Ga0373925_0099092 3300037068 Bacteria 2238
93 Ga0373925_0382114 3300037068 Bacteria 1147
94 Ga0439464_0016431 3300042439 Bacteria 2001
95 Ga0451577_0002579 3300042876 Bacteria 21385
96 Ga0451577_0013290 3300042876 Bacteria 7712
97 Ga0453684_0013359 3300044712 Bacteria 13351
98 Ga0453684_0016394 3300044712 Bacteria 11589
99 Ga0453684_0020287 3300044712 Bacteria 10038
100 Ga0453684_0324437 3300044712 Unclassified 1743
101 Ga0451576_0282668 3300045051 Unclassified 1735
102 Ga0495592_0019820 3300046454 Bacteria 5114
103 Ga0495592_0090614 3300046454 Bacteria 2194
104 Ga0495641_0018643 3300046461 Bacteria 3576
105 Ga0495641_0061746 3300046461 Bacteria 1691
106 Ga0495582_0014213 3300046473 Bacteria 4378
107 Ga0495582_0196910 3300046473 Unclassified 1150
108 Ga0495639_0011494 3300046475 Bacteria 3818
109 Ga0495662_0026814 3300046476 Unclassified 2783
110 Ga0495608_0063593 3300046511 Bacteria 2421
111 Ga0495630_0000043 3300046517 Bacteria 104062
112 Ga0495630_0052857 3300046517 Bacteria 3041
113 Ga0495630_0073473 3300046517 Bacteria 2575
114 Ga0495630_0102915 3300046517 Bacteria 2161
115 Ga0495630_0330795 3300046517 Unclassified 1165
116 Ga0495666_0010831 3300046526 Bacteria 4547
117 Ga0495640_0024368 3300046533 Unclassified 4403
118 Ga0495640_0038423 3300046533 Bacteria 3367
119 Ga0495586_0000763 3300046535 Bacteria 18505
120 Ga0495586_0000878 3300046535 Bacteria 17220
121 Ga0495586_0001087 3300046535 Bacteria 15369
122 Ga0495645_0107448 3300046543 Unclassified 1978
123 Ga0495645_0165386 3300046543 Bacteria 1526
124 Ga0495667_0077430 3300046559 Bacteria 2163
125 Ga0495634_0018601 3300046642 Bacteria 4943
126 Ga0495634_0048797 3300046642 Bacteria 2848
127 Ga0495635_0194492 3300046663 Bacteria 1377
128 Ga0495599_0044342 3300046678 Bacteria 2789
129 Ga0495599_0145484 3300046678 Bacteria 1469
130 Ga0495647_0004828 3300046681 Bacteria 4404
131 Ga0495647_0058515 3300046681 Bacteria 1515
132 Ga0495658_0003876 3300046683 Bacteria 7402
133 Ga0495658_0089219 3300046683 Bacteria 1824
134 Ga0495613_0000995 3300046689 Bacteria 21526
135 Ga0495613_0003056 3300046689 Bacteria 12505
136 Ga0495624_0043775 3300046690 Bacteria 2855
137 Ga0495624_0111340 3300046690 Bacteria 1683
138 Ga0495600_0098028 3300046809 Bacteria 1911
139 Ga0495581_0149476 3300047315 Bacteria 1364
140 Ga0495604_0269257 3300047317 Bacteria 1155
141 Ga0495674_0000046 3300047319 Bacteria 81912
142 Ga0495676_0201939 3300047321 Bacteria 1381
143 Ga0495680_0101569 3300047322 Bacteria 2142
144 Ga0495684_0139492 3300047471 Bacteria 1818
145 Ga0495684_0326440 3300047471 Unclassified 1096
146 Ga0496101_0115121 3300048904 Bacteria 2028
147 Ga0496104_0008633 3300048907 Bacteria 9064
148 Ga0496105_0021584 3300048908 Bacteria 5212
149 Ga0496110_0457854 3300048913 Bacteria 1162
150 Ga0496114_0003029 3300048917 Bacteria 12885
151 Ga0496114_0190671 3300048917 Bacteria 1793
152 Ga0496115_0005285 3300048918 Bacteria 9390
153 Ga0501033_0013357 3300049570 Bacteria 6257
154 Ga0501033_0016206 3300049570 Bacteria 5644
155 Ga0501034_0135993 3300049571 Bacteria 2439
156 Ga0501037_0047184 3300049573 Bacteria 3158
157 Ga0501043_0074034 3300049579 Bacteria 2675
158 Ga0501043_0135505 3300049579 Bacteria 1929
159 Ga0501047_0283534 3300049581 Bacteria 1501
160 Ga0501035_0247858 3300049822 Bacteria 1513
161 Ga0495601_0127579 3300053077 Bacteria 1655
162 Ga0495595_0010702 3300053084 Bacteria 3820
163 Ga0500650_0011264 3300053098 Bacteria 3675
164 Ga0373962_0072016
165 Ga0065707_10104382
166 Ga0070670_100127976
167 Ga0070666_10037579
168 Ga0070660_100139222
169 Ga0070668_100241539
170 Ga0070675_100179496
171 Ga0070667_100120290
172 Ga0070714_100024100
173 Ga0070711_100242499
174 Ga0070681_10089025
175 Ga0070685_10178020
176 Ga0070679_100056517
177 Ga0068853_100061627
178 Ga0068855_100033400
179 Ga0068856_100154031
180 Ga0068864_100041995
181 Ga0068863_100155068
182 Ga0068863_100308694
183 Ga0075436_100060011
184 Ga0099795_10051647
185 Ga0105240_10001894
186 Ga0105240_10038985
187 Ga0105240_10049077
188 Ga0105240_10632028
189 Ga0111539_10034661
190 Ga0105245_10066586
191 Ga0105245_10355155
192 Ga0105243_10172838
193 Ga0105242_10024829
194 Ga0105248_10026477
195 Ga0105238_10011717
196 Ga0105249_10413621
197 Ga0105239_10057812
198 Ga0157370_10067472
199 Ga0157370_10097332
200 Ga0157374_10165964
201 Ga0157374_10175213
202 Ga0157378_10091751
203 Ga0163162_10179517
204 Ga0157375_10000027
205 Ga0157375_10016227
206 Ga0163163_10003791
207 Ga0163163_10058150
208 Ga0157376_10214988
209 Ga0163161_10054671
210 Ga0207680_10010663
211 Ga0207645_10050169
212 Ga0207707_10044308
213 Ga0207707_10141447
214 Ga0207695_10019289
215 Ga0207695_10076224
216 Ga0207663_10175433
217 Ga0207652_10271103
218 Ga0207694_10078167
219 Ga0207650_10140906
220 Ga0207687_10101880
221 Ga0207664_10020307
222 Ga0207711_10057002
223 Ga0207667_10020005
224 Ga0207667_10175172
225 Ga0207641_10477735
226 Ga0207648_10123016
227 Ga0207676_10049645
228 Ga0268266_10089771
229 Ga0265337_1002847
230 Ga0265337_1007762
231 Ga0265326_10022006
232 Ga0265319_1000001
233 Ga0265338_10002229
234 Ga0265338_10003980
235 Ga0265338_10007727
236 Ga0265338_10029107
237 Ga0265320_10028122
238 Ga0265329_10001177
239 Ga0265340_10002122
240 Ga0265340_10005183
241 Ga0265340_10012148
242 Ga0265327_10000581
243 Ga0307408_100145545
244 Ga0265313_10004898
245 Ga0265314_10000046
246 Ga0307411_10066645
247 Ga0373953_0010030
248 Ga0373954_0018959
249 Ga0373927_0011926
250 Ga0373937_0002253
251 Ga0373937_0077992
252 Ga0316584_0050263
253 Ga0373925_0004773
254 Ga0373925_0010716
255 Ga0373925_0099092
256 Ga0373925_0382114
257 Ga0439464_0016431
258 Ga0451577_0002579
259 Ga0451577_0013290
260 Ga0453684_0013359
261 Ga0453684_0016394
262 Ga0453684_0020287
263 Ga0453684_0324437
264 Ga0451576_0282668
265 Ga0495592_0019820
266 Ga0495592_0090614
267 Ga0495641_0018643
268 Ga0495641_0061746
269 Ga0495582_0014213
270 Ga0495582_0196910
271 Ga0495639_0011494
272 Ga0495662_0026814
273 Ga0495608_0063593
274 Ga0495630_0000043
275 Ga0495630_0052857
276 Ga0495630_0073473
277 Ga0495630_0102915
278 Ga0495630_0330795
279 Ga0495666_0010831
280 Ga0495640_0024368
281 Ga0495640_0038423
282 Ga0495586_0000763
283 Ga0495586_0000878
284 Ga0495586_0001087
285 Ga0495645_0107448
286 Ga0495645_0165386
287 Ga0495667_0077430
288 Ga0495634_0018601
289 Ga0495634_0048797
290 Ga0495635_0194492
291 Ga0495599_0044342
292 Ga0495599_0145484
293 Ga0495647_0004828
294 Ga0495647_0058515
295 Ga0495658_0003876
296 Ga0495658_0089219
297 Ga0495613_0000995
298 Ga0495613_0003056
299 Ga0495624_0043775
300 Ga0495624_0111340
301 Ga0495600_0098028
302 Ga0495581_0149476
303 Ga0495604_0269257
304 Ga0495674_0000046
305 Ga0495676_0201939
306 Ga0495680_0101569
307 Ga0495684_0139492
308 Ga0495684_0326440
309 Ga0496101_0115121
310 Ga0496104_0008633
311 Ga0496105_0021584
312 Ga0496110_0457854
313 Ga0496114_0003029
314 Ga0496114_0190671
315 Ga0496115_0005285
316 Ga0501033_0013357
317 Ga0501033_0016206
318 Ga0501034_0135993
319 Ga0501037_0047184
320 Ga0501043_0074034
321 Ga0501043_0135505
322 Ga0501047_0283534
323 Ga0501035_0247858
324 Ga0495601_0127579
325 Ga0495595_0010702
326 Ga0500650_0011264

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00762

Ferrochelatase

Ferrochelatase

1

304

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pnj-assembly1.cif.gz_A crystal structure of human ferrochelatase mutant with phe 337 replaced by ala 0.8725 2 339
2hre-assembly1.cif.gz_A structure of human ferrochelatase variant e343k with protoporphyrin ix bound 0.8634 2 339
4klc-assembly1.cif.gz_B e343d/f110a double mutant of human ferrochelatase 0.8563 2 339
3aqi-assembly1.cif.gz_B h240a variant of human ferrochelatase 0.851 2 339
4kmm-assembly1.cif.gz_B m76h variant of human ferrochelatase 0.8505 2 339
ID Description Score Start End Superfamily
af_P23871_6_161_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9628 5 156 3.40.50.1400
af_P23871_6_250_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9493 5 266 3.40.605.10
af_P23871_188_298_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9448 184 314 3.40.50.1400
af_P23871_6_250_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.938 5 266 3.40.605.10
af_P23871_6_161_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.933 5 156 3.40.50.1400
ID Description Score Start End GO Terms
AF-A0A3N9NYZ3-F1-model_v4 Ferrochelatase (EC 4.98.1.1) (Heme synthase) (Protoheme ferro-lyase) 0.9944 1 331 GO:0004325
GO:0005737
GO:0006783
GO:0046872
AF-A0A383CEG3-F1-model_v4 Ferrochelatase 0.9928 9 183 GO:0004325
GO:0006783
AF-A0A7C3WFC2-F1-model_v4 Ferrochelatase (EC 4.99.1.1) 0.9923 1 238 GO:0004325
GO:0006783
AF-A0A800IK26-F1-model_v4 Ferrochelatase (EC 4.98.1.1) (Heme synthase) (Protoheme ferro-lyase) 0.9892 1 335 GO:0004325
GO:0005737
GO:0006783
GO:0046872
AF-A0A1G7W3V4-F1-model_v4 Ferrochelatase (EC 4.98.1.1) (Heme synthase) (Protoheme ferro-lyase) 0.9873 2 336 GO:0004325
GO:0005737
GO:0006783
GO:0046872

Map