F241044

General Info

Members Datasets Scaffolds Average Seq Length
163 93 163 137

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_100315396|Ga0070705_1003153961
Length 145
Sequence MTDRAAKENDAMSNESRTDMQRVEQTLTSVPEQTRPGPVYMPAVDIFETDGAITVLADMPGVKPDQLEIDLRENVLTITARVTAAPANETDVLREYDAGTFFRRFTLAETIDQAKIDAKLADGVLRLELPKLERAKPRQITVRTG

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
24 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
33 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
34 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
35 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
49 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
51 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
52 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
53 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
54 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
55 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
56 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
57 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
58 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
59 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
60 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
61 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
62 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
63 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
64 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
65 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
66 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
67 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
68 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
69 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
70 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
71 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
72 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
73 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
74 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
75 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
76 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
79 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
80 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
81 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
82 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
83 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
84 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
85 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
86 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
87 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
88 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
89 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
90 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
91 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
92 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
93 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.87
Metatranscriptomes 6.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.61
Rhizosphere 95.71
Stem 0
Stem Tuber 0
Unclassified 3.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10088776 3300003323 Bacteria 4867
2 Ga0058859_11308068 3300004798 Unclassified 1085
3 Ga0058860_11576932 3300004801 Unclassified 1127
4 Ga0068869_100060875 3300005334 Viruses 2768
5 Ga0070689_100021481 3300005340 Bacteria 4806
6 Ga0070689_101274601 3300005340 Unclassified 661
7 Ga0070692_10599088 3300005345 Unclassified 729
8 Ga0070688_101121662 3300005365 Unclassified 629
9 Ga0070701_10018695 3300005438 Viruses 3261
10 Ga0070705_100222300 3300005440 Bacteria 1308
11 Ga0070705_100315396 3300005440 Bacteria 1126
12 Ga0070694_101342871 3300005444 Unclassified 602
13 Ga0070678_100154358 3300005456 Bacteria 1853
14 Ga0070685_10420753 3300005466 Unclassified 929
15 Ga0070684_102062179 3300005535 Bacteria 538
16 Ga0070704_100704559 3300005549 Bacteria 896
17 Ga0068857_101626195 3300005577 Unclassified 631
18 Ga0068859_100492908 3300005617 Bacteria 1320
19 Ga0068859_100731752 3300005617 Unclassified 1079
20 Ga0068859_100839961 3300005617 Bacteria 1005
21 Ga0068864_100309769 3300005618 Bacteria 1480
22 Ga0068861_100126656 3300005719 Bacteria 2067
23 Ga0068863_100125044 3300005841 Bacteria 2453
24 Ga0068863_100217930 3300005841 Bacteria 1838
25 Ga0068860_101324542 3300005843 Unclassified 741
26 Ga0075428_100625033 3300006844 Unclassified 1149
27 Ga0075428_101430980 3300006844 Bacteria 725
28 Ga0075430_100618989 3300006846 Unclassified 893
29 Ga0068865_100290534 3300006881 Unclassified 1305
30 Ga0075436_100046996 3300006914 Unclassified 2977
31 Ga0097620_100492887 3300006931 Bacteria 1320
32 Ga0097620_100731865 3300006931 Unclassified 1079
33 Ga0097620_100839990 3300006931 Bacteria 1005
34 Ga0075435_100356107 3300007076 Unclassified 1255
35 Ga0111539_10155036 3300009094 Bacteria 2680
36 Ga0111539_10451113 3300009094 Unclassified 1498
37 Ga0111539_10646785 3300009094 Bacteria 1231
38 Ga0111539_12044958 3300009094 Unclassified 664
39 Ga0105247_10147336 3300009101 Bacteria 1548
40 Ga0114129_10318644 3300009147 Unclassified 2067
41 Ga0105243_11194712 3300009148 Unclassified 773
42 Ga0105249_10151136 3300009553 Bacteria 2236
43 Ga0105249_10232201 3300009553 Bacteria 1820
44 Ga0157375_10759666 3300013308 Bacteria 1120
45 Ga0157380_11111563 3300014326 Unclassified 830
46 Ga0157377_11453502 3300014745 Unclassified 543
47 Ga0206350_11078199 3300020080 Unclassified 878
48 Ga0207680_11192905 3300025903 Unclassified 543
49 Ga0207695_10987795 3300025913 Unclassified 721
50 Ga0207709_11024763 3300025935 Bacteria 675
51 Ga0207670_10010956 3300025936 Bacteria 5239
52 Ga0207670_10730112 3300025936 Unclassified 822
53 Ga0207689_10033717 3300025942 Bacteria 4253
54 Ga0207712_10146490 3300025961 Bacteria 1818
55 Ga0207712_10404528 3300025961 Bacteria 1148
56 Ga0207677_10399774 3300026023 Bacteria 1165
57 Ga0207708_10337123 3300026075 Bacteria 1234
58 Ga0207641_10240996 3300026088 Bacteria 1685
59 Ga0207674_10854596 3300026116 Unclassified 877
60 Ga0207675_100005638 3300026118 Bacteria 11983
61 Ga0207675_100018919 3300026118 Bacteria 6429
62 Ga0207675_100212793 3300026118 Bacteria 1860
63 Ga0207683_10219084 3300026121 Unclassified 1734
64 Ga0207428_10209469 3300027907 Bacteria 1465
65 Ga0207428_10685568 3300027907 Unclassified 733
66 Ga0268264_11292677 3300028381 Bacteria 739
67 Ga0268264_11338212 3300028381 Unclassified 726
68 Ga0265337_1017248 3300028556 Bacteria 2319
69 Ga0265326_10015387 3300028558 Unclassified 2220
70 Ga0265326_10177111 3300028558 Unclassified 611
71 Ga0265319_1026254 3300028563 Bacteria 2078
72 Ga0265334_10010652 3300028573 Bacteria 3881
73 Ga0265334_10042584 3300028573 Bacteria 1769
74 Ga0265318_10000119 3300028577 Bacteria 72544
75 Ga0265318_10057850 3300028577 Bacteria 1448
76 Ga0265318_10061832 3300028577 Unclassified 1395
77 Ga0265318_10077205 3300028577 Unclassified 1231
78 Ga0265323_10022900 3300028653 Unclassified 2385
79 Ga0265323_10029284 3300028653 Bacteria 2061
80 Ga0265323_10103362 3300028653 Bacteria 941
81 Ga0265323_10111619 3300028653 Bacteria 897
82 Ga0265322_10056184 3300028654 Unclassified 1116
83 Ga0265338_10025541 3300028800 Bacteria 5990
84 Ga0265338_10070820 3300028800 Bacteria 2987
85 Ga0265338_10162177 3300028800 Unclassified 1725
86 Ga0265338_10605336 3300028800 Bacteria 763
87 Ga0265324_10000538 3300029957 Bacteria 25978
88 Ga0307511_10055620 3300030521 Bacteria 3104
89 Ga0265330_10003216 3300031235 Bacteria 8606
90 Ga0265330_10022208 3300031235 Bacteria 2889
91 Ga0265330_10035235 3300031235 Bacteria 2234
92 Ga0265330_10131422 3300031235 Bacteria 1065
93 Ga0265330_10195685 3300031235 Unclassified 855
94 Ga0265332_10000544 3300031238 Bacteria 25487
95 Ga0265332_10033854 3300031238 Bacteria 2223
96 Ga0265328_10001379 3300031239 Bacteria 11213
97 Ga0265328_10143030 3300031239 Unclassified 898
98 Ga0265320_10005642 3300031240 Bacteria 7995
99 Ga0265320_10174689 3300031240 Bacteria 964
100 Ga0265325_10019466 3300031241 Bacteria 3752
101 Ga0265329_10000211 3300031242 Bacteria 30333
102 Ga0265329_10001884 3300031242 Bacteria 9899
103 Ga0265340_10155849 3300031247 Unclassified 1039
104 Ga0265339_10000120 3300031249 Bacteria 64460
105 Ga0265339_10001897 3300031249 Bacteria 15341
106 Ga0265339_10027664 3300031249 Unclassified 3232
107 Ga0265331_10007131 3300031250 Bacteria 6503
108 Ga0265331_10045140 3300031250 Unclassified 2128
109 Ga0265331_10056390 3300031250 Bacteria 1866
110 Ga0265316_10000806 3300031344 Bacteria 34583
111 Ga0265316_10002419 3300031344 Bacteria 19411
112 Ga0265316_10006049 3300031344 Bacteria 11627
113 Ga0265316_10006661 3300031344 Bacteria 11002
114 Ga0265316_10014852 3300031344 Bacteria 6832
115 Ga0265316_10026369 3300031344 Bacteria 4834
116 Ga0265316_10092723 3300031344 Unclassified 2302
117 Ga0265316_10318016 3300031344 Bacteria 1131
118 Ga0265313_10020590 3300031595 Bacteria 3636
119 Ga0265313_10090264 3300031595 Bacteria 1377
120 Ga0265313_10237546 3300031595 Unclassified 747
121 Ga0265314_10001329 3300031711 Bacteria 28010
122 Ga0265314_10006672 3300031711 Bacteria 10143
123 Ga0265314_10020649 3300031711 Bacteria 5083
124 Ga0265314_10162457 3300031711 Bacteria 1357
125 Ga0265342_10000378 3300031712 Bacteria 49176
126 Ga0265342_10001987 3300031712 Bacteria 18239
127 Ga0265342_10005012 3300031712 Bacteria 10220
128 Ga0265342_10031301 3300031712 Bacteria 3291
129 Ga0265342_10060056 3300031712 Unclassified 2243
130 Ga0265342_10072192 3300031712 Bacteria 2010
131 Ga0265342_10093698 3300031712 Unclassified 1719
132 Ga0265342_10241491 3300031712 Bacteria 967
133 Ga0316576_10688785 3300031727 Unclassified 741
134 Ga0316578_10174143 3300031728 Bacteria 1297
135 Ga0316578_10218204 3300031728 Unclassified 1147
136 Ga0316578_10750213 3300031728 Unclassified 567
137 Ga0307411_10382381 3300032005 Unclassified 1158
138 Ga0316593_10060841 3300032168 Bacteria 1291
139 Ga0316593_10071450 3300032168 Bacteria 1201
140 Ga0316593_10094026 3300032168 Bacteria 1057
141 Ga0316593_10104607 3300032168 Unclassified 1007
142 Ga0316593_10159077 3300032168 Unclassified 824
143 Ga0316593_10214752 3300032168 Bacteria 713
144 Ga0316592_1026017 3300033524 Bacteria 1262
145 Ga0373937_0914700 3300036401 Bacteria 826
146 Ga0316582_0023789 3300036647 Bacteria 3655
147 Ga0436363_0961159 3300039450 Bacteria 1676
148 Ga0451837_0473605 3300041494 Unclassified 1455
149 Ga0453684_0200147 3300044712 Bacteria 2329
150 Ga0495658_0428715 3300046683 Unclassified 844
151 Ga0496106_1105705 3300048909 Unclassified 621
152 Ga0501071_1483173 3300049587 Bacteria 523
153 Ga0501044_1129652 3300049823 Unclassified 652
154 nmdc:mga05p37_1029662_c1 3300050507 Unclassified 871
155 nmdc:mga0qj67_550091_c1 3300050509 Unclassified 926
156 nmdc:mga08y16_1293413_c1 3300050511 Unclassified 696
157 nmdc:mga08y16_500870_c1 3300050511 Bacteria 1234
158 nmdc:mga08y16_62327_c1 3300050511 Bacteria 3894
159 nmdc:mga0n895_284523_c1 3300050512 Bacteria 1676
160 nmdc:mga0rr50_343233_c1 3300050513 Unclassified 1255
161 nmdc:mga08x19_216646_c1 3300050514 Unclassified 1315
162 nmdc:mga0a205_430789_c1 3300050515 Bacteria 1180
163 nmdc:mga0a205_816772_c1 3300050515 Unclassified 780

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025903 Ga0207680_11192905 Ga0207680_111929052 125
2 3300006846 Ga0075430_100618989 Ga0075430_1006189892 128
3 3300028556 Ga0265337_1017248 Ga0265337_10172483 128
4 3300028653 Ga0265323_10111619 Ga0265323_101116192 128
5 3300028800 Ga0265338_10070820 Ga0265338_100708204 128
6 3300028800 Ga0265338_10605336 Ga0265338_106053361 128
7 3300029957 Ga0265324_10000538 Ga0265324_100005389 128
8 3300031240 Ga0265320_10174689 Ga0265320_101746892 128
9 3300031249 Ga0265339_10000120 Ga0265339_1000012014 128
10 3300031344 Ga0265316_10318016 Ga0265316_103180162 128
11 3300031595 Ga0265313_10090264 Ga0265313_100902641 128
12 3300007076 Ga0075435_100356107 Ga0075435_1003561072 129
13 3300028800 Ga0265338_10025541 Ga0265338_100255415 129
14 3300050513 nmdc:mga0rr50_343233_c1 nmdc:mga0rr50_343233_c1_567_968 129
15 3300004798 Ga0058859_11308068 Ga0058859_113080681 130
16 3300004801 Ga0058860_11576932 Ga0058860_115769321 130
17 3300005334 Ga0068869_100060875 Ga0068869_1000608752 130
18 3300005340 Ga0070689_100021481 Ga0070689_1000214816 130
19 3300005340 Ga0070689_101274601 Ga0070689_1012746012 130
20 3300005345 Ga0070692_10599088 Ga0070692_105990881 130
21 3300005438 Ga0070701_10018695 Ga0070701_100186955 130
22 3300005440 Ga0070705_100315396 Ga0070705_1003153961 130
23 3300005444 Ga0070694_101342871 Ga0070694_1013428711 130
24 3300005577 Ga0068857_101626195 Ga0068857_1016261951 130
25 3300005617 Ga0068859_100839961 Ga0068859_1008399612 130
26 3300005618 Ga0068864_100309769 Ga0068864_1003097693 130
27 3300006844 Ga0075428_101430980 Ga0075428_1014309801 130
28 3300006931 Ga0097620_100839990 Ga0097620_1008399902 130
29 3300009094 Ga0111539_10155036 Ga0111539_101550364 130
30 3300009094 Ga0111539_10646785 Ga0111539_106467852 130
31 3300009148 Ga0105243_11194712 Ga0105243_111947121 130
32 3300009553 Ga0105249_10232201 Ga0105249_102322013 130
33 3300025936 Ga0207670_10010956 Ga0207670_100109561 130
34 3300025942 Ga0207689_10033717 Ga0207689_100337177 130
35 3300026116 Ga0207674_10854596 Ga0207674_108545962 130
36 3300027907 Ga0207428_10209469 Ga0207428_102094692 130
37 3300027907 Ga0207428_10685568 Ga0207428_106855682 130
38 3300028558 Ga0265326_10177111 Ga0265326_101771111 130
39 3300050511 nmdc:mga08y16_500870_c1 nmdc:mga08y16_500870_c1_249_647 130
40 3300050511 nmdc:mga08y16_62327_c1 nmdc:mga08y16_62327_c1_2744_3142 130
41 3300050512 nmdc:mga0n895_284523_c1 nmdc:mga0n895_284523_c1_310_708 130
42 3300050515 nmdc:mga0a205_430789_c1 nmdc:mga0a205_430789_c1_289_687 130
43 3300050515 nmdc:mga0a205_816772_c1 nmdc:mga0a205_816772_c1_16_414 130
44 3300005719 Ga0068861_100126656 Ga0068861_1001266562 131
45 3300020080 Ga0206350_11078199 Ga0206350_110781992 131
46 3300025913 Ga0207695_10987795 Ga0207695_109877951 131
47 3300026118 Ga0207675_100212793 Ga0207675_1002127932 131
48 3300028381 Ga0268264_11292677 Ga0268264_112926772 131
49 3300028577 Ga0265318_10061832 Ga0265318_100618323 131
50 3300030521 Ga0307511_10055620 Ga0307511_100556203 131
51 3300031712 Ga0265342_10005012 Ga0265342_100050125 131
52 3300039450 Ga0436363_0961159 Ga0436363_0961159_598_1023 131
53 3300003323 rootH1_10088776 rootH1_100887764 132
54 3300005365 Ga0070688_101121662 Ga0070688_1011216621 132
55 3300005440 Ga0070705_100222300 Ga0070705_1002223001 132
56 3300005456 Ga0070678_100154358 Ga0070678_1001543583 132
57 3300005466 Ga0070685_10420753 Ga0070685_104207531 132
58 3300005535 Ga0070684_102062179 Ga0070684_1020621791 132
59 3300005549 Ga0070704_100704559 Ga0070704_1007045591 132
60 3300005617 Ga0068859_100492908 Ga0068859_1004929083 132
61 3300005617 Ga0068859_100731752 Ga0068859_1007317522 132
62 3300005841 Ga0068863_100125044 Ga0068863_1001250443 132
63 3300005841 Ga0068863_100217930 Ga0068863_1002179303 132
64 3300005843 Ga0068860_101324542 Ga0068860_1013245422 132
65 3300006844 Ga0075428_100625033 Ga0075428_1006250332 132
66 3300006881 Ga0068865_100290534 Ga0068865_1002905342 132
67 3300006914 Ga0075436_100046996 Ga0075436_1000469965 132
68 3300006931 Ga0097620_100492887 Ga0097620_1004928871 132
69 3300006931 Ga0097620_100731865 Ga0097620_1007318652 132
70 3300009094 Ga0111539_10451113 Ga0111539_104511134 132
71 3300009094 Ga0111539_12044958 Ga0111539_120449581 132
72 3300009101 Ga0105247_10147336 Ga0105247_101473363 132
73 3300009147 Ga0114129_10318644 Ga0114129_103186443 132
74 3300009553 Ga0105249_10151136 Ga0105249_101511363 132
75 3300013308 Ga0157375_10759666 Ga0157375_107596662 132
76 3300014326 Ga0157380_11111563 Ga0157380_111115631 132
77 3300014745 Ga0157377_11453502 Ga0157377_114535021 132
78 3300025935 Ga0207709_11024763 Ga0207709_110247632 132
79 3300025936 Ga0207670_10730112 Ga0207670_107301121 132
80 3300025961 Ga0207712_10146490 Ga0207712_101464903 132
81 3300025961 Ga0207712_10404528 Ga0207712_104045282 132
82 3300026023 Ga0207677_10399774 Ga0207677_103997743 132
83 3300026075 Ga0207708_10337123 Ga0207708_103371231 132
84 3300026088 Ga0207641_10240996 Ga0207641_102409962 132
85 3300026118 Ga0207675_100005638 Ga0207675_1000056388 132
86 3300026118 Ga0207675_100018919 Ga0207675_1000189193 132
87 3300026121 Ga0207683_10219084 Ga0207683_102190843 132
88 3300028381 Ga0268264_11338212 Ga0268264_113382122 132
89 3300028558 Ga0265326_10015387 Ga0265326_100153871 132
90 3300028563 Ga0265319_1026254 Ga0265319_10262542 132
91 3300028573 Ga0265334_10010652 Ga0265334_100106523 132
92 3300028573 Ga0265334_10042584 Ga0265334_100425843 132
93 3300028577 Ga0265318_10000119 Ga0265318_1000011936 132
94 3300028577 Ga0265318_10057850 Ga0265318_100578502 132
95 3300028577 Ga0265318_10077205 Ga0265318_100772051 132
96 3300028653 Ga0265323_10022900 Ga0265323_100229003 132
97 3300028653 Ga0265323_10029284 Ga0265323_100292842 132
98 3300028653 Ga0265323_10103362 Ga0265323_101033623 132
99 3300028654 Ga0265322_10056184 Ga0265322_100561842 132
100 3300028800 Ga0265338_10162177 Ga0265338_101621773 132
101 3300031235 Ga0265330_10003216 Ga0265330_100032164 132
102 3300031235 Ga0265330_10022208 Ga0265330_100222082 132
103 3300031235 Ga0265330_10035235 Ga0265330_100352354 132
104 3300031235 Ga0265330_10131422 Ga0265330_101314221 132
105 3300031235 Ga0265330_10195685 Ga0265330_101956851 132
106 3300031238 Ga0265332_10000544 Ga0265332_1000054417 132
107 3300031238 Ga0265332_10033854 Ga0265332_100338541 132
108 3300031239 Ga0265328_10001379 Ga0265328_100013795 132
109 3300031239 Ga0265328_10143030 Ga0265328_101430302 132
110 3300031240 Ga0265320_10005642 Ga0265320_100056424 132
111 3300031241 Ga0265325_10019466 Ga0265325_100194662 132
112 3300031242 Ga0265329_10000211 Ga0265329_1000021115 132
113 3300031242 Ga0265329_10001884 Ga0265329_100018843 132
114 3300031247 Ga0265340_10155849 Ga0265340_101558492 132
115 3300031249 Ga0265339_10001897 Ga0265339_100018978 132
116 3300031249 Ga0265339_10027664 Ga0265339_100276643 132
117 3300031250 Ga0265331_10007131 Ga0265331_100071313 132
118 3300031250 Ga0265331_10045140 Ga0265331_100451404 132
119 3300031250 Ga0265331_10056390 Ga0265331_100563902 132
120 3300031344 Ga0265316_10000806 Ga0265316_1000080615 132
121 3300031344 Ga0265316_10002419 Ga0265316_1000241911 132
122 3300031344 Ga0265316_10006049 Ga0265316_1000604911 132
123 3300031344 Ga0265316_10006661 Ga0265316_1000666113 132
124 3300031344 Ga0265316_10014852 Ga0265316_100148522 132
125 3300031344 Ga0265316_10026369 Ga0265316_100263693 132
126 3300031344 Ga0265316_10092723 Ga0265316_100927232 132
127 3300031595 Ga0265313_10020590 Ga0265313_100205904 132
128 3300031595 Ga0265313_10237546 Ga0265313_102375462 132
129 3300031711 Ga0265314_10001329 Ga0265314_1000132911 132
130 3300031711 Ga0265314_10006672 Ga0265314_1000667211 132
131 3300031711 Ga0265314_10020649 Ga0265314_100206498 132
132 3300031711 Ga0265314_10162457 Ga0265314_101624571 132
133 3300031712 Ga0265342_10000378 Ga0265342_1000037816 132
134 3300031712 Ga0265342_10001987 Ga0265342_1000198714 132
135 3300031712 Ga0265342_10031301 Ga0265342_100313013 132
136 3300031712 Ga0265342_10060056 Ga0265342_100600562 132
137 3300031712 Ga0265342_10072192 Ga0265342_100721922 132
138 3300031712 Ga0265342_10093698 Ga0265342_100936982 132
139 3300031712 Ga0265342_10241491 Ga0265342_102414912 132
140 3300031727 Ga0316576_10688785 Ga0316576_106887852 132
141 3300031728 Ga0316578_10174143 Ga0316578_101741432 132
142 3300031728 Ga0316578_10218204 Ga0316578_102182043 132
143 3300031728 Ga0316578_10750213 Ga0316578_107502131 132
144 3300032005 Ga0307411_10382381 Ga0307411_103823812 132
145 3300032168 Ga0316593_10060841 Ga0316593_100608412 132
146 3300032168 Ga0316593_10071450 Ga0316593_100714501 132
147 3300032168 Ga0316593_10094026 Ga0316593_100940262 132
148 3300032168 Ga0316593_10104607 Ga0316593_101046071 132
149 3300032168 Ga0316593_10159077 Ga0316593_101590771 132
150 3300032168 Ga0316593_10214752 Ga0316593_102147522 132
151 3300033524 Ga0316592_1026017 Ga0316592_10260172 132
152 3300036401 Ga0373937_0914700 Ga0373937_0914700_33_476 132
153 3300036647 Ga0316582_0023789 Ga0316582_0023789_3041_3451 132
154 3300041494 Ga0451837_0473605 Ga0451837_0473605_544_1008 132
155 3300044712 Ga0453684_0200147 Ga0453684_0200147_1280_1684 132
156 3300046683 Ga0495658_0428715 Ga0495658_0428715_117_560 132
157 3300048909 Ga0496106_1105705 Ga0496106_1105705_50_460 132
158 3300049587 Ga0501071_1483173 Ga0501071_1483173_23_433 132
159 3300049823 Ga0501044_1129652 Ga0501044_1129652_55_465 132
160 3300050507 nmdc:mga05p37_1029662_c1 nmdc:mga05p37_1029662_c1_242_652 132
161 3300050509 nmdc:mga0qj67_550091_c1 nmdc:mga0qj67_550091_c1_291_713 132
162 3300050511 nmdc:mga08y16_1293413_c1 nmdc:mga08y16_1293413_c1_117_527 132
163 3300050514 nmdc:mga08x19_216646_c1 nmdc:mga08x19_216646_c1_80_523 132

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00011

HSP20

Hsp20/alpha crystallin family

45

143

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rzk-assembly1.cif.gz_B crystal structure of sulfolobus solfataricus hsp20.1 acd 0.8833 23 118
5ds2-assembly2.cif.gz_D core domain of the class i small heat-shock protein hsp 18.1 from pisum sativum 0.8553 28 118
2h50-assembly1.cif.gz_P multiple distinct assemblies reveal conformational flexibility in the small heat shock protein hsp26 0.8451 29 118
5ds1-assembly1.cif.gz_A-2 core domain of the class ii small heat-shock protein hsp 17.7 from pisum sativum 0.8386 28 116
4rzk-assembly1.cif.gz_B crystal structure of sulfolobus solfataricus hsp20.1 acd 0.8375 23 118
ID Description Score Start End Superfamily
4rzkB00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8833 23 118 2.60.40.790
af_I1JA98_161_252_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8673 28 120 2.60.40.790
af_A4I9J1_8_137_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8589 28 117 2.60.40.790
5ds2D00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8553 28 118 2.60.40.790
af_Q4DXK9_8_134_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.847 26 117 2.60.40.790
ID Description Score Start End GO Terms
AF-A0A7Y5JMD1-F1-model_v4 Hsp20/alpha crystallin family protein 0.8396 17 120
AF-A0A1M2ZAL5-F1-model_v4 SHSP domain-containing protein 0.8361 26 130
AF-A0A814YB87-F1-model_v4 SHSP domain-containing protein 0.8204 24 118 GO:0005525
AF-A0A7V1JEQ8-F1-model_v4 Hsp20/alpha crystallin family protein 0.8168 23 124
AF-A0A2N1T1W6-F1-model_v4 deleted 0.8155 26 132

Feature Viewer

pLDDT pTM Quality
81.59 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map