F240410

General Info

Members Datasets Scaffolds Average Seq Length
162 107 322 169

Family's Representative Sequence

Representative Sequence 3300053156|Ga0500622_0358595|Ga0500622_0358595_33_581
Length 182
Sequence MMGPILETDRLILRQLQLSDLDDLFALYRDPDIRRYFPEGTLTRSETLHELTWFAEGGDPAHPELGLWATIHKDTQAFIGRCGLIPWTIDGKLEIEIAYLLAKPYWGQGLGGEVAQALVRYGFATLGLSRLIALIDPDNEASARTAMKAGLRHEKNIDHDGVACSVYAIEKRDGPRASHEDY

Samples

Sample ID Description Type Environment
1 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
13 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
14 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
17 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
24 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
25 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
33 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
36 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
37 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
38 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
44 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
45 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
46 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
47 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
48 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
49 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
50 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
51 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
52 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
53 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
54 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
55 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
56 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
57 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
58 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
59 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
60 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
61 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
62 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
63 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
64 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
65 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
66 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
67 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
68 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
69 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
70 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
72 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
73 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
81 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
82 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
83 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
84 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
85 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
86 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
87 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
88 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
89 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
90 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
91 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
92 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
93 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
94 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
97 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
98 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
99 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
100 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
101 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
102 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
103 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
104 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
105 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
106 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
107 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.23
Nodule 0
Rhizoplane 8.02
Rhizosphere 90.12
Stem 0
Stem Tuber 0
Unclassified 30.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500622_0358595 3300053156 Unclassified 603
2 rootH2_10157416 3300003320 Bacteria 1285
3 Ga0065704_10040675 3300005289 Unclassified 1054
4 Ga0065704_10257820 3300005289 Unclassified 973
5 Ga0065712_10179202 3300005290 Unclassified 1196
6 Ga0070674_100133996 3300005356 Unclassified 1851
7 Ga0070701_10395164 3300005438 Unclassified 875
8 Ga0070705_100114874 3300005440 Unclassified 1727
9 Ga0070700_100118203 3300005441 Unclassified 1772
10 Ga0070706_100319756 3300005467 Bacteria 1447
11 Ga0070698_100261923 3300005471 Bacteria 1661
12 Ga0070698_100793628 3300005471 Unclassified 891
13 Ga0070684_100066709 3300005535 Unclassified 3159
14 Ga0070686_100055080 3300005544 Bacteria 2546
15 Ga0070704_100054299 3300005549 Bacteria 2835
16 Ga0070664_100337963 3300005564 Unclassified 1367
17 Ga0068857_100567901 3300005577 Bacteria 1070
18 Ga0070702_101460043 3300005615 Unclassified 561
19 Ga0068870_10039011 3300005840 Unclassified 2456
20 Ga0068863_100557075 3300005841 Bacteria 1132
21 Ga0068858_100384081 3300005842 Bacteria 1348
22 Ga0081455_10089300 3300005937 Bacteria 2501
23 Ga0075428_100459612 3300006844 Bacteria 1363
24 Ga0075428_100495117 3300006844 Bacteria 1308
25 Ga0075430_101243550 3300006846 Bacteria 613
26 Ga0075433_10006509 3300006852 Bacteria 9240
27 Ga0075433_10389451 3300006852 Unclassified 1230
28 Ga0075434_100260396 3300006871 Bacteria 1753
29 Ga0075429_100122664 3300006880 Bacteria 2271
30 Ga0111539_10288940 3300009094 Unclassified 1908
31 Ga0105245_10260182 3300009098 Unclassified 1689
32 Ga0105245_10508345 3300009098 Bacteria 1222
33 Ga0114129_10038089 3300009147 Bacteria 6784
34 Ga0114129_10054108 3300009147 Bacteria 5628
35 Ga0114129_10285018 3300009147 Bacteria 2206
36 Ga0114129_10435634 3300009147 Bacteria 1722
37 Ga0105243_10054285 3300009148 Unclassified 3181
38 Ga0105243_10123806 3300009148 Bacteria 2184
39 Ga0105249_11168136 3300009553 Bacteria 840
40 Ga0105239_10005200 3300010375 Bacteria 15312
41 Ga0105246_10054351 3300011119 Bacteria 2759
42 Ga0105246_10165980 3300011119 Unclassified 1686
43 Ga0105246_10175077 3300011119 Bacteria 1647
44 Ga0105246_10247350 3300011119 Bacteria 1413
45 Ga0163162_10435800 3300013306 Bacteria 1443
46 Ga0163162_12101047 3300013306 Unclassified 648
47 Ga0163163_10838505 3300014325 Bacteria 983
48 Ga0163163_10855550 3300014325 Bacteria 973
49 Ga0157377_10256990 3300014745 Bacteria 1135
50 Ga0157379_10366414 3300014968 Bacteria 1321
51 Ga0157376_10594204 3300014969 Unclassified 1101
52 Ga0207709_10040660 3300025935 Unclassified 2785
53 Ga0207709_10681598 3300025935 Unclassified 821
54 Ga0207703_10333206 3300026035 Bacteria 1393
55 Ga0207641_11277350 3300026088 Bacteria 734
56 Ga0207674_10045520 3300026116 Unclassified 4513
57 Ga0207675_100301735 3300026118 Bacteria 1560
58 Ga0207675_101228957 3300026118 Unclassified 770
59 Ga0265318_10033368 3300028577 Bacteria 1988
60 Ga0316574_0708259 3300035398 Bacteria 617
61 Ga0451577_0134539 3300042876 Bacteria 2219
62 Ga0451577_0181640 3300042876 Bacteria 1897
63 Ga0451577_0318976 3300042876 Unclassified 1409
64 Ga0451577_0588552 3300042876 Bacteria 1010
65 Ga0451577_0734052 3300042876 Bacteria 894
66 Ga0451577_0920692 3300042876 Unclassified 787
67 Ga0451577_0956827 3300042876 Bacteria 770
68 Ga0451577_0973155 3300042876 Bacteria 763
69 Ga0453683_0270527 3300044673 Bacteria 1084
70 Ga0453684_0000859 3300044712 Bacteria 102253
71 Ga0453684_0009141 3300044712 Bacteria 17440
72 Ga0453684_0046388 3300044712 Bacteria 5780
73 Ga0453684_0049435 3300044712 Bacteria 5546
74 Ga0453684_0160405 3300044712 Unclassified 2661
75 Ga0453684_0282843 3300044712 Unclassified 1891
76 Ga0453684_0285549 3300044712 Bacteria 1880
77 Ga0453684_0310258 3300044712 Bacteria 1790
78 Ga0453684_0325376 3300044712 Bacteria 1740
79 Ga0453684_0362360 3300044712 Bacteria 1632
80 Ga0453684_0520211 3300044712 Bacteria 1315
81 Ga0453684_0603990 3300044712 Bacteria 1202
82 Ga0453684_0801991 3300044712 Unclassified 1015
83 Ga0453684_1060825 3300044712 Unclassified 858
84 Ga0453684_1216733 3300044712 Bacteria 790
85 Ga0453684_2014309 3300044712 Bacteria 581
86 Ga0451576_0102768 3300045051 Bacteria 2973
87 Ga0451576_0123613 3300045051 Bacteria 2695
88 Ga0451576_1799300 3300045051 Unclassified 633
89 Ga0495596_0051204 3300046500 Unclassified 1618
90 Ga0495642_0557517 3300046528 Unclassified 508
91 Ga0495658_0793366 3300046683 Bacteria 606
92 Ga0495669_0391885 3300046684 Unclassified 673
93 Ga0495676_0125118 3300047321 Bacteria 1864
94 Ga0495677_0204832 3300047445 Unclassified 767
95 Ga0496100_0189325 3300048903 Bacteria 1493
96 Ga0496101_0479725 3300048904 Bacteria 982
97 Ga0496104_0333510 3300048907 Bacteria 1430
98 Ga0496106_0185228 3300048909 Unclassified 1654
99 Ga0496108_0000300 3300048911 Bacteria 42451
100 Ga0496108_0087651 3300048911 Bacteria 2644
101 Ga0496109_0009000 3300048912 Bacteria 8502
102 Ga0496109_1500875 3300048912 Bacteria 609
103 Ga0496110_0087077 3300048913 Unclassified 2790
104 Ga0496110_0148515 3300048913 Bacteria 2121
105 Ga0496112_0110955 3300048915 Bacteria 2713
106 Ga0496113_0083296 3300048916 Bacteria 2454
107 Ga0496114_0534907 3300048917 Bacteria 1036
108 Ga0501031_0000263 3300049568 Bacteria 29643
109 Ga0501032_0090259 3300049569 Bacteria 2033
110 Ga0501033_0000208 3300049570 Bacteria 56046
111 Ga0501034_0034602 3300049571 Bacteria 5122
112 Ga0501036_0000195 3300049572 Bacteria 40369
113 Ga0501037_0004127 3300049573 Bacteria 10536
114 Ga0501038_0018590 3300049574 Bacteria 6276
115 Ga0501039_0004187 3300049575 Bacteria 10866
116 Ga0501040_0000457 3300049576 Bacteria 24248
117 Ga0501040_0853769 3300049576 Bacteria 659
118 Ga0501041_0002169 3300049577 Bacteria 11072
119 Ga0501042_0251767 3300049578 Bacteria 1274
120 Ga0501043_0004723 3300049579 Bacteria 11045
121 Ga0501046_0020056 3300049580 Bacteria 5535
122 Ga0501047_0001330 3300049581 Bacteria 24244
123 Ga0501048_0001878 3300049582 Bacteria 15945
124 Ga0501068_0008140 3300049584 Bacteria 5822
125 Ga0501069_0050370 3300049585 Bacteria 2315
126 Ga0501070_0008373 3300049586 Bacteria 8737
127 Ga0501071_0000429 3300049587 Bacteria 20989
128 Ga0501072_0028556 3300049588 Unclassified 4355
129 Ga0501072_0382875 3300049588 Unclassified 1116
130 Ga0501073_0019842 3300049589 Bacteria 4850
131 Ga0501074_0000118 3300049590 Bacteria 40043
132 Ga0501075_0001702 3300049591 Bacteria 14455
133 Ga0501076_0090150 3300049592 Bacteria 2465
134 Ga0501076_0165268 3300049592 Unclassified 1804
135 Ga0501077_0001338 3300049593 Bacteria 14869
136 Ga0501079_0015634 3300049741 Bacteria 5795
137 Ga0501080_0014603 3300049742 Bacteria 7234
138 Ga0501080_0572294 3300049742 Unclassified 1005
139 Ga0501081_0257576 3300049743 Bacteria 1274
140 Ga0501083_0000227 3300049744 Bacteria 36195
141 Ga0501035_0003847 3300049822 Bacteria 14309
142 Ga0501044_0000984 3300049823 Bacteria 34240
143 Ga0501045_0008837 3300049824 Bacteria 7036
144 nmdc:mga05p37_115683_c1 3300050507 Unclassified 3296
145 nmdc:mga05p37_18163_c1 3300050507 Bacteria 8497
146 nmdc:mga09592_767867_c1 3300050508 Bacteria 817
147 nmdc:mga0qj67_913336_c1 3300050509 Bacteria 691
148 nmdc:mga06r32_342993_c1 3300050510 Unclassified 1478
149 nmdc:mga08y16_107296_c1 3300050511 Bacteria 2907
150 nmdc:mga08y16_565012_c1 3300050511 Unclassified 1150
151 nmdc:mga0n895_1306410_c1 3300050512 Unclassified 696
152 nmdc:mga0n895_1809449_c1 3300050512 Unclassified 571
153 nmdc:mga0a205_108538_c1 3300050515 Bacteria 2674
154 nmdc:mga0a205_403716_c1 3300050515 Unclassified 1230
155 nmdc:mga0a205_7490_c1 3300050515 Bacteria 9885
156 Ga0500644_0087445 3300053088 Bacteria 1159
157 Ga0501084_0028351 3300054114 Bacteria 4679
158 Ga0501082_0005279 3300060353 Bacteria 11229
159 Ga0530510_0019372 3300061734 Bacteria 4828
160 Ga0530510_0890107 3300061734 Unclassified 680
161 Ga0530510_0939451 3300061734 Unclassified 661
162 Ga0500622_0358595
163 rootH2_10157416
164 Ga0065704_10040675
165 Ga0065704_10257820
166 Ga0065712_10179202
167 Ga0070674_100133996
168 Ga0070701_10395164
169 Ga0070705_100114874
170 Ga0070700_100118203
171 Ga0070706_100319756
172 Ga0070698_100261923
173 Ga0070698_100793628
174 Ga0070684_100066709
175 Ga0070686_100055080
176 Ga0070704_100054299
177 Ga0070664_100337963
178 Ga0068857_100567901
179 Ga0070702_101460043
180 Ga0068870_10039011
181 Ga0068863_100557075
182 Ga0068858_100384081
183 Ga0081455_10089300
184 Ga0075428_100459612
185 Ga0075428_100495117
186 Ga0075430_101243550
187 Ga0075433_10006509
188 Ga0075433_10389451
189 Ga0075434_100260396
190 Ga0075429_100122664
191 Ga0111539_10288940
192 Ga0105245_10260182
193 Ga0105245_10508345
194 Ga0114129_10038089
195 Ga0114129_10054108
196 Ga0114129_10285018
197 Ga0114129_10435634
198 Ga0105243_10054285
199 Ga0105243_10123806
200 Ga0105249_11168136
201 Ga0105239_10005200
202 Ga0105246_10054351
203 Ga0105246_10165980
204 Ga0105246_10175077
205 Ga0105246_10247350
206 Ga0163162_10435800
207 Ga0163162_12101047
208 Ga0163163_10838505
209 Ga0163163_10855550
210 Ga0157377_10256990
211 Ga0157379_10366414
212 Ga0157376_10594204
213 Ga0207709_10040660
214 Ga0207709_10681598
215 Ga0207703_10333206
216 Ga0207641_11277350
217 Ga0207674_10045520
218 Ga0207675_100301735
219 Ga0207675_101228957
220 Ga0265318_10033368
221 Ga0316574_0708259
222 Ga0451577_0134539
223 Ga0451577_0181640
224 Ga0451577_0318976
225 Ga0451577_0588552
226 Ga0451577_0734052
227 Ga0451577_0920692
228 Ga0451577_0956827
229 Ga0451577_0973155
230 Ga0453683_0270527
231 Ga0453684_0000859
232 Ga0453684_0009141
233 Ga0453684_0046388
234 Ga0453684_0049435
235 Ga0453684_0160405
236 Ga0453684_0282843
237 Ga0453684_0285549
238 Ga0453684_0310258
239 Ga0453684_0325376
240 Ga0453684_0362360
241 Ga0453684_0520211
242 Ga0453684_0603990
243 Ga0453684_0801991
244 Ga0453684_1060825
245 Ga0453684_1216733
246 Ga0453684_2014309
247 Ga0451576_0102768
248 Ga0451576_0123613
249 Ga0451576_1799300
250 Ga0495596_0051204
251 Ga0495642_0557517
252 Ga0495658_0793366
253 Ga0495669_0391885
254 Ga0495676_0125118
255 Ga0495677_0204832
256 Ga0496100_0189325
257 Ga0496101_0479725
258 Ga0496104_0333510
259 Ga0496106_0185228
260 Ga0496108_0000300
261 Ga0496108_0087651
262 Ga0496109_0009000
263 Ga0496109_1500875
264 Ga0496110_0087077
265 Ga0496110_0148515
266 Ga0496112_0110955
267 Ga0496113_0083296
268 Ga0496114_0534907
269 Ga0501031_0000263
270 Ga0501032_0090259
271 Ga0501033_0000208
272 Ga0501034_0034602
273 Ga0501036_0000195
274 Ga0501037_0004127
275 Ga0501038_0018590
276 Ga0501039_0004187
277 Ga0501040_0000457
278 Ga0501040_0853769
279 Ga0501041_0002169
280 Ga0501042_0251767
281 Ga0501043_0004723
282 Ga0501046_0020056
283 Ga0501047_0001330
284 Ga0501048_0001878
285 Ga0501068_0008140
286 Ga0501069_0050370
287 Ga0501070_0008373
288 Ga0501071_0000429
289 Ga0501072_0028556
290 Ga0501072_0382875
291 Ga0501073_0019842
292 Ga0501074_0000118
293 Ga0501075_0001702
294 Ga0501076_0090150
295 Ga0501076_0165268
296 Ga0501077_0001338
297 Ga0501079_0015634
298 Ga0501080_0014603
299 Ga0501080_0572294
300 Ga0501081_0257576
301 Ga0501083_0000227
302 Ga0501035_0003847
303 Ga0501044_0000984
304 Ga0501045_0008837
305 nmdc:mga05p37_115683_c1
306 nmdc:mga05p37_18163_c1
307 nmdc:mga09592_767867_c1
308 nmdc:mga0qj67_913336_c1
309 nmdc:mga06r32_342993_c1
310 nmdc:mga08y16_107296_c1
311 nmdc:mga08y16_565012_c1
312 nmdc:mga0n895_1306410_c1
313 nmdc:mga0n895_1809449_c1
314 nmdc:mga0a205_108538_c1
315 nmdc:mga0a205_403716_c1
316 nmdc:mga0a205_7490_c1
317 Ga0500644_0087445
318 Ga0501084_0028351
319 Ga0501082_0005279
320 Ga0530510_0019372
321 Ga0530510_0890107
322 Ga0530510_0939451

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

10

152

0.89

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

21

151

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kpp-assembly1.cif.gz_A structure of the e102a mutant of a gnat superfamily pa3944 acetyltransferase 0.8981 4 178
3v8h-assembly2.cif.gz_B crystal structure of thymidylate synthase from burkholderia thailandensis 0.8872 132 174
3v8h-assembly1.cif.gz_A crystal structure of thymidylate synthase from burkholderia thailandensis 0.8758 132 174
3v8h-assembly1.cif.gz_D crystal structure of thymidylate synthase from burkholderia thailandensis 0.8754 132 174
2fsr-assembly1.cif.gz_A crystal structure of the acetyltransferase from agrobacterium tumefaciens str. c58 0.8739 6 171
ID Description Score Start End Superfamily
af_Q55B20_2_174_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9465 10 175 3.40.630.30
af_Q2FUT4_1_162_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.925 8 157 3.40.630.30
af_Q55B20_2_174_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9043 10 175 3.40.630.30
af_Q2G0B8_3_165_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8977 8 162 3.40.630.30
af_Q54L65_11_183_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8952 8 171 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A402AY76-F1-model_v4 N-acetyltransferase domain-containing protein 0.989 98 172 GO:0016747
AF-A0A841Q222-F1-model_v4 RimJ/RimL family protein N-acetyltransferase 0.9799 96 172 GO:0016747
AF-A0A2V9CQ62-F1-model_v4 N-acetyltransferase domain-containing protein 0.974 98 171 GO:0016747
AF-A0A521T0I7-F1-model_v4 N-acetyltransferase 0.9683 75 181 GO:0016747
AF-A0A7C3GH82-F1-model_v4 N-acetyltransferase 0.9654 100 172 GO:0016747

Map