F240388

General Info

Members Datasets Scaffolds Average Seq Length
162 130 324 314

Family's Representative Sequence

Representative Sequence 3300053096|Ga0500641_0018359|Ga0500641_0018359_1155_2177
Length 340
Sequence MQTGHGVTGFGRQDGDMTSPTSPTTHDRIPADFPEPTLISVNGVELEVFEAGRQNAGKPIVLCHGWPEHAFSWRHQMPALAAAGYHVIVPNQRGYGNSSRPTEVTEYDLERLSGDLVALLDHYGYEDATFVGHDWGAMVVWGLTLLHPHRVNAVINLSLPYQERGEKPWIEFMEEILGGDFYFVHFNRQPGVADAVLDENTFRFLRNLYRKNEPLREPEPGMVMINLANAETPRGEPLMSDSELAVFVSAFETSGFTGGINWYRNLDRNWRLLADVNPIIQQPALMIYGDRDAIQRSEKLTDFVPNAEVVTLDCGHWIQQEKPEETNQAILKWLDQRDAT

Samples

Sample ID Description Type Environment
1 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
6 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
8 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
9 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
10 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
11 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
12 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
13 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
14 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
15 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
19 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
20 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
21 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
22 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
23 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
24 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
25 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
26 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
27 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
28 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
29 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
30 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
31 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
32 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
33 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
34 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
35 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
36 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
37 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
38 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
39 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
40 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
41 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
42 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
43 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
44 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
45 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
46 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
47 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
48 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
49 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
50 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
51 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
52 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
53 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
54 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
55 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
56 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
57 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
58 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
59 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
60 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
61 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
62 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
63 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
64 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
65 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
66 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
67 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
68 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
69 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
70 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
71 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
72 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
73 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
74 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
75 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
76 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
77 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
78 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
79 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
80 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
81 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
82 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
83 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
84 2643221578 Streptomyces sp. Root63 Isolate Unclassified
85 2643221591 Devosia sp. Root685 Isolate Unclassified
86 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
87 2643221613 Oerskovia sp. Root22 Isolate Unclassified
88 2643221630 Microbacterium sp. Root322 Isolate Unclassified
89 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
90 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
91 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
92 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
93 2643221721 Oerskovia sp. Root918 Isolate Unclassified
94 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
95 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
96 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
97 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
98 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
99 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
100 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
101 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
102 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
103 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
104 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
105 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
106 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
107 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
108 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
109 2891562705 Microbispora tritici MT50 Isolate Unclassified
110 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
111 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
112 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
113 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
114 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
115 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
116 2922554459 Rhodococcus sp. 66b Isolate Unclassified
117 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
118 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
119 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
120 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
121 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
122 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
123 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
124 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
125 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
126 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
127 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
128 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
129 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
130 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 66.05
Metatranscriptomes 0
Isolates 33.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.11
Nodule 0.62
Rhizoplane 3.09
Rhizosphere 41.98
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500641_0018359 3300053096 Bacteria 2630
2 rootL2_10241498 3300003322 Bacteria 1376
3 rootH1_10038868 3300003323 Bacteria 12477
4 Ga0065704_10080114 3300005289 Bacteria 4007
5 Ga0070665_100492410 3300005548 Bacteria 1237
6 Ga0081538_10008394 3300005981 Bacteria 8779
7 Ga0075364_10055094 3300006051 Bacteria 2602
8 Ga0075369_10047716 3300006186 Bacteria 1847
9 Ga0105244_10000343 3300009036 Bacteria 43808
10 Ga0105243_10000239 3300009148 Bacteria 62933
11 Ga0105243_10045250 3300009148 Bacteria 3457
12 Ga0105243_10047074 3300009148 Bacteria 3394
13 Ga0157369_10447498 3300013105 Bacteria 1338
14 Ga0183367_1014 3300015688 Bacteria 330534
15 Ga0207655_1003898 3300025728 Bacteria 10838
16 Ga0207652_10322521 3300025921 Bacteria 1394
17 Ga0207644_10321152 3300025931 Bacteria 1252
18 Ga0207709_10000346 3300025935 Bacteria 47628
19 Ga0207709_10130974 3300025935 Bacteria 1710
20 Ga0207668_10016985 3300025972 Bacteria 4553
21 Ga0307515_10000042 3300028794 Bacteria 309141
22 Ga0307515_10016842 3300028794 Bacteria 13360
23 Ga0307512_10015657 3300030522 Bacteria 7018
24 Ga0314311_1166832 3300030733 Bacteria 4956
25 Ga0307513_10001160 3300031456 Bacteria 38156
26 Ga0307513_10001240 3300031456 Bacteria 36941
27 Ga0307513_10004617 3300031456 Bacteria 18346
28 Ga0307513_10039725 3300031456 Bacteria 5213
29 Ga0307513_10072731 3300031456 Bacteria 3582
30 Ga0307509_10061174 3300031507 Bacteria 3977
31 Ga0307514_10024200 3300031649 Bacteria 4919
32 Ga0307516_10001584 3300031730 Bacteria 31288
33 Ga0307516_10100944 3300031730 Bacteria 2701
34 Ga0307516_10298551 3300031730 Bacteria 1287
35 Ga0307406_10000703 3300031901 Bacteria 18900
36 Ga0307416_100000003 3300032002 Bacteria 509060
37 Ga0307414_10006502 3300032004 Bacteria 6517
38 Ga0307414_10053465 3300032004 Bacteria 2816
39 Ga0307414_10095436 3300032004 Bacteria 2222
40 Ga0307414_10233043 3300032004 Bacteria 1519
41 Ga0307414_10404924 3300032004 Bacteria 1186
42 Ga0307510_10108825 3300033180 Bacteria 2523
43 Ga0400484_18685 3300038725 Bacteria 1596
44 Ga0400490_40115 3300038726 Bacteria 4369
45 Ga0400485_02280 3300038735 Bacteria 1876
46 Ga0400485_02965 3300038735 Bacteria 4220
47 Ga0400485_20783 3300038735 Bacteria 12761
48 Ga0400488_03697 3300038741 Bacteria 1938
49 Ga0400486_18257 3300038742 Bacteria 1818
50 Ga0400486_25799 3300038742 Bacteria 1744
51 Ga0400486_32364 3300038742 Bacteria 12733
52 Ga0400483_030427 3300039062 Bacteria 19118
53 Ga0400483_170314 3300039062 Bacteria 3801
54 Ga0400487_07752 3300039110 Bacteria 1842
55 Ga0451797_0791973 3300041453 Bacteria 1414
56 Ga0451807_2600260 3300041486 Bacteria 1336
57 Ga0451849_0376328 3300041505 Bacteria 1154
58 Ga0451853_1288363 3300041512 Bacteria 7095
59 Ga0451853_3584723 3300041512 Bacteria 8410
60 Ga0439449_0016245 3300042007 Bacteria 2798
61 Ga0466965_0002568 3300044683 Bacteria 7757
62 Ga0466968_0004352 3300044735 Bacteria 5286
63 Ga0466968_0033439 3300044735 Bacteria 2142
64 Ga0466960_0001586 3300044901 Bacteria 8318
65 Ga0495629_0002906 3300046459 Bacteria 13070
66 Ga0495638_0167092 3300046460 Bacteria 1265
67 Ga0495638_0196321 3300046460 Bacteria 1142
68 Ga0495594_0021479 3300046499 Bacteria 3446
69 Ga0495608_0221211 3300046511 Bacteria 1188
70 Ga0495668_0000634 3300046616 Bacteria 42294
71 Ga0495625_0074743 3300046660 Bacteria 2372
72 Ga0495588_0004285 3300046674 Bacteria 6290
73 Ga0495636_0129708 3300047318 Bacteria 1121
74 Ga0495685_006101 3300047447 Bacteria 3943
75 Ga0495614_0001195 3300048089 Bacteria 11153
76 Ga0496108_0000280 3300048911 Bacteria 43780
77 Ga0496108_0245632 3300048911 Bacteria 1557
78 Ga0496111_0090391 3300048914 Bacteria 2243
79 Ga0496116_0024413 3300048919 Bacteria 4473
80 Ga0496122_0000188 3300048925 Bacteria 143808
81 Ga0496123_0053567 3300048926 Bacteria 2665
82 Ga0496123_0156421 3300048926 Bacteria 1221
83 Ga0496124_0000456 3300048927 Bacteria 71405
84 Ga0496125_0000188 3300048928 Bacteria 134959
85 Ga0496125_0000600 3300048928 Bacteria 61362
86 Ga0496125_0113805 3300048928 Bacteria 1950
87 Ga0496126_0004167 3300048929 Bacteria 17451
88 Ga0496126_0008718 3300048929 Bacteria 10892
89 Ga0496126_0038290 3300048929 Bacteria 4464
90 Ga0501034_0027243 3300049571 Bacteria 5814
91 Ga0501034_0054691 3300049571 Bacteria 4018
92 Ga0501257_000977 3300049686 Bacteria 5754
93 nmdc:mga0sz30_49166_c1 3300050516 Bacteria 1786
94 Ga0500578_0170387 3300053086 Bacteria 1346
95 Ga0500646_0001181 3300053090 Bacteria 7020
96 Ga0500650_0091814 3300053098 Bacteria 1421
97 Ga0500652_027107 3300053131 Bacteria 2213
98 Ga0500652_084654 3300053131 Bacteria 1321
99 Ga0500561_0000710 3300053137 Bacteria 5286
100 Ga0500579_052296 3300053143 Bacteria 2489
101 Ga0500579_110361 3300053143 Bacteria 1386
102 Ga0500600_0063945 3300053149 Bacteria 2040
103 Ga0500616_0000040 3300053153 Bacteria 367604
104 Ga0500616_0007485 3300053153 Bacteria 6927
105 Ga0500622_0000084 3300053156 Bacteria 100802
106 Ga0500633_0009807 3300053160 Bacteria 2534
107 Ga0500634_0069676 3300053161 Bacteria 1843
108 2563927248 2563366752 Bacteria 4961801
109 2566996885 2565956761 Bacteria 6601618
110 2587680690 2585428045 Bacteria 5203023
111 2587864111 2585428094 Bacteria 3604039
112 2588213529 2585428183 Bacteria 5166119
113 2590600886 2588254255 Bacteria 5014294
114 2590612712 2588254257 Bacteria 5436094
115 2643734622 2643221542 Bacteria 3563959
116 2643903366 2643221578 Bacteria 9213798
117 2643966399 2643221591 Bacteria 4397626
118 2644016572 2643221601 Bacteria 7493239
119 2644082509 2643221613 Bacteria 4622396
120 2644172776 2643221630 Bacteria 3601215
121 2644178970 2643221631 Bacteria 8168043
122 2644404124 2643221673 Bacteria 9196637
123 2644505540 2643221690 Bacteria 4654705
124 2644524332 2643221694 Bacteria 4392972
125 2644665365 2643221721 Bacteria 4486924
126 2644668431 2643221722 Bacteria 4247614
127 2738890196 2738541308 Bacteria 7020677
128 2739204770 2738543005 Bacteria 5278128
129 2753072874 2751185734 Bacteria 8863695
130 2753671102 2751185877 Bacteria 4921427
131 2793183186 2791355222 Bacteria 5898266
132 2809587912 2808606522 Bacteria 9488490
133 2856745135 2856741275 Bacteria 8096094
134 2865005047 2865002811 Bacteria 6333767
135 2868092960 2868088558 Bacteria 7609351
136 2871721305 2871720351 Bacteria 4862476
137 2873319841 2873314349 Bacteria 8512634
138 2884997912 2884994152 Bacteria 4492978
139 2889048702 2889042446 Bacteria 7618936
140 2889290933 2889290771 Bacteria 5530962
141 2891563142 2891562705 Bacteria 8039471
142 2904115153 2904113452 Bacteria 7796941
143 2904496661 2904490793 Bacteria 7046938
144 2904540041 2904535858 Bacteria 6308016
145 2905999742 2905999023 Bacteria 4591259
146 2912761486 2912757875 Bacteria 7940295
147 2919695594 2919692658 Bacteria 5943958
148 2922560545 2922554459 Bacteria 6683962
149 2931385815 2931384279 Bacteria 7299545
150 2935892050 2935890801 Bacteria 4593001
151 2938653060 2938649242 Bacteria 7118381
152 2939594043 2939593269 Bacteria 4798695
153 2946042890 2946041624 Bacteria 4191385
154 2946083387 2946080515 Bacteria 4310960
155 2968558602 2968558590 Bacteria 6956864
156 2971414873 2971410472 Bacteria 8311090
157 2996637562 2996632988 Bacteria 6921523
158 8003861585 8003856774 Bacteria 7675274
159 8055066190 8055066027 Bacteria 9479577
160 8055536270 8055531788 Bacteria 5249694
161 8056539455 8056533031 Bacteria 8964429
162 8057982220 8057977335 Bacteria 5694872
163 Ga0500641_0018359
164 rootL2_10241498
165 rootH1_10038868
166 Ga0065704_10080114
167 Ga0070665_100492410
168 Ga0081538_10008394
169 Ga0075364_10055094
170 Ga0075369_10047716
171 Ga0105244_10000343
172 Ga0105243_10000239
173 Ga0105243_10045250
174 Ga0105243_10047074
175 Ga0157369_10447498
176 Ga0183367_1014
177 Ga0207655_1003898
178 Ga0207652_10322521
179 Ga0207644_10321152
180 Ga0207709_10000346
181 Ga0207709_10130974
182 Ga0207668_10016985
183 Ga0307515_10000042
184 Ga0307515_10016842
185 Ga0307512_10015657
186 Ga0314311_1166832
187 Ga0307513_10001160
188 Ga0307513_10001240
189 Ga0307513_10004617
190 Ga0307513_10039725
191 Ga0307513_10072731
192 Ga0307509_10061174
193 Ga0307514_10024200
194 Ga0307516_10001584
195 Ga0307516_10100944
196 Ga0307516_10298551
197 Ga0307406_10000703
198 Ga0307416_100000003
199 Ga0307414_10006502
200 Ga0307414_10053465
201 Ga0307414_10095436
202 Ga0307414_10233043
203 Ga0307414_10404924
204 Ga0307510_10108825
205 Ga0400484_18685
206 Ga0400490_40115
207 Ga0400485_02280
208 Ga0400485_02965
209 Ga0400485_20783
210 Ga0400488_03697
211 Ga0400486_18257
212 Ga0400486_25799
213 Ga0400486_32364
214 Ga0400483_030427
215 Ga0400483_170314
216 Ga0400487_07752
217 Ga0451797_0791973
218 Ga0451807_2600260
219 Ga0451849_0376328
220 Ga0451853_1288363
221 Ga0451853_3584723
222 Ga0439449_0016245
223 Ga0466965_0002568
224 Ga0466968_0004352
225 Ga0466968_0033439
226 Ga0466960_0001586
227 Ga0495629_0002906
228 Ga0495638_0167092
229 Ga0495638_0196321
230 Ga0495594_0021479
231 Ga0495608_0221211
232 Ga0495668_0000634
233 Ga0495625_0074743
234 Ga0495588_0004285
235 Ga0495636_0129708
236 Ga0495685_006101
237 Ga0495614_0001195
238 Ga0496108_0000280
239 Ga0496108_0245632
240 Ga0496111_0090391
241 Ga0496116_0024413
242 Ga0496122_0000188
243 Ga0496123_0053567
244 Ga0496123_0156421
245 Ga0496124_0000456
246 Ga0496125_0000188
247 Ga0496125_0000600
248 Ga0496125_0113805
249 Ga0496126_0004167
250 Ga0496126_0008718
251 Ga0496126_0038290
252 Ga0501034_0027243
253 Ga0501034_0054691
254 Ga0501257_000977
255 nmdc:mga0sz30_49166_c1
256 Ga0500578_0170387
257 Ga0500646_0001181
258 Ga0500650_0091814
259 Ga0500652_027107
260 Ga0500652_084654
261 Ga0500561_0000710
262 Ga0500579_052296
263 Ga0500579_110361
264 Ga0500600_0063945
265 Ga0500616_0000040
266 Ga0500616_0007485
267 Ga0500622_0000084
268 Ga0500633_0009807
269 Ga0500634_0069676
270 2563927248
271 2566996885
272 2587680690
273 2587864111
274 2588213529
275 2590600886
276 2590612712
277 2643734622
278 2643903366
279 2643966399
280 2644016572
281 2644082509
282 2644172776
283 2644178970
284 2644404124
285 2644505540
286 2644524332
287 2644665365
288 2644668431
289 2738890196
290 2739204770
291 2753072874
292 2753671102
293 2793183186
294 2809587912
295 2856745135
296 2865005047
297 2868092960
298 2871721305
299 2873319841
300 2884997912
301 2889048702
302 2889290933
303 2891563142
304 2904115153
305 2904496661
306 2904540041
307 2905999742
308 2912761486
309 2919695594
310 2922560545
311 2931385815
312 2935892050
313 2938653060
314 2939594043
315 2946042890
316 2946083387
317 2968558602
318 2971414873
319 2996637562
320 8003861585
321 8055066190
322 8055536270
323 8056539455
324 8057982220

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12146

Hydrolase_4

Serine aminopeptidase, S33

54

190

0.84

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

58

323

0.79

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

60

329

0.55

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cw2-assembly4.cif.gz_D crystal structure of epoxide hydrolase a from mycobacterium thermoresistibile 0.8954 15 316
5xm6-assembly1.cif.gz_C the overall structure of vreh2 0.8948 16 317
7cg6-assembly1.cif.gz_B vigna radiata epoxide hydrolase mutant m263q 0.8947 16 317
7cg2-assembly1.cif.gz_B vigna radiata epoxide hydrolase mutant 0.8936 16 317
5y5d-assembly1.cif.gz_B the crystal structure of vreh2 mutant m263w 0.89 16 317
ID Description Score Start End Superfamily
af_A0A0R0KMM0_1_93_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9558 16 106 3.40.50.12270
af_A0A0R0KMM0_1_93_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8964 16 106 3.40.50.12270
5cw2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8874 15 315 3.40.50.1820
af_B6SUW2_10_323_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.883 16 317 3.40.50.1820
3pdcA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8796 13 316 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A1I3U8I9-F1-model_v4 Pimeloyl-ACP methyl ester carboxylesterase 0.9871 94 319 GO:0003824
AF-B5GUK2-F1-model_v4 Putative epoxide hydrolase 0.9818 9 317 GO:0016787
AF-A0A090PPK7-F1-model_v4 deleted 0.9812 139 319
AF-A0A090PPK7-F1-model_v4 deleted 0.9655 139 319
AF-A0A7R7UPZ8-F1-model_v4 deleted 0.9549 16 122

Map