F240352
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 162 | 124 | 324 | 287 |
Family's Representative Sequence
| Representative Sequence | 3300050507|nmdc:mga05p37_668009_c1|nmdc:mga05p37_668009_c1_23_958 |
| Length | 311 |
| Sequence | MMTARRDRAAMPHDYGVSPTVEDTPEDELLDTTRVIGRAVGVLSAAGVGSPRVDAELIAAHVLGVPRGRLALSPEMTRPQARRFRELVARRAERVPLQHLLGTAPFYGLEIPVGPGVFVPRPETELLVEWGLRVLPAGTVTVVDLCSGSGAIALAVVRERPQARVYAVERDPAALEWLRRNASGHPVEVVAGDATDPTVLSTLDGQVDLVLCNPPYVRAGTPVAPEVGRHDPYPAVFAGPDGLDVIAPLVPRVARLLKRGGWFGVEHDDSHRTAVPALLRANGCFTDVADHDDLARRPRFATARRLADCIP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 18 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 19 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 20 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 21 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 22 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 23 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 24 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 26 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 27 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 28 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 29 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 35 | 3300009984 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG | Metagenome | Rhizosphere |
| 36 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 41 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 42 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 61 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 62 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 63 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 64 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 65 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 66 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 67 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 68 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 69 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 70 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 71 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 72 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 73 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 74 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 75 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 76 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 77 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 78 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 79 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 80 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 81 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 82 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 83 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 84 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 85 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 86 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 87 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 89 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 90 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 91 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 92 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 93 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 94 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 95 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 96 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 97 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 98 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 99 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 100 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 101 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 102 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 104 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 105 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 106 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 107 | 2582580736 | Prauserella sp. Am3 | Isolate | Unclassified |
| 108 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 109 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 110 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 111 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 112 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 113 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 114 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 115 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 116 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 117 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 118 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 119 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 120 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 121 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 122 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 123 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 124 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.65 |
| Metatranscriptomes | 0.62 |
| Isolates | 11.73 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.23 |
| Nodule | 0 |
| Rhizoplane | 5.56 |
| Rhizosphere | 76.54 |
| Stem | 0 |
| Stem Tuber | 0.62 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | nmdc:mga05p37_668009_c1 | 3300050507 | Bacteria | 1160 |
| 2 | JGI25406J46586_10018657 | 3300003203 | Bacteria | 2847 |
| 3 | Ga0070658_10004462 | 3300005327 | Bacteria | 11395 |
| 4 | Ga0070683_100015389 | 3300005329 | Bacteria | 6719 |
| 5 | Ga0070680_100196683 | 3300005336 | Bacteria | 1700 |
| 6 | Ga0070682_100029036 | 3300005337 | Bacteria | 3329 |
| 7 | Ga0070661_100066664 | 3300005344 | Bacteria | 2645 |
| 8 | Ga0070668_100005783 | 3300005347 | Bacteria | 9173 |
| 9 | Ga0070659_100044970 | 3300005366 | Bacteria | 3459 |
| 10 | Ga0070714_100010686 | 3300005435 | Bacteria | 7265 |
| 11 | Ga0070700_100000032 | 3300005441 | Bacteria | 114995 |
| 12 | Ga0070663_100000669 | 3300005455 | Bacteria | 18399 |
| 13 | Ga0070663_100076867 | 3300005455 | Bacteria | 2443 |
| 14 | Ga0070681_10331626 | 3300005458 | Bacteria | 1431 |
| 15 | Ga0070679_100029351 | 3300005530 | Bacteria | 5427 |
| 16 | Ga0070684_100131546 | 3300005535 | Bacteria | 2257 |
| 17 | Ga0070684_100164407 | 3300005535 | Bacteria | 2014 |
| 18 | Ga0070664_100074942 | 3300005564 | Bacteria | 2905 |
| 19 | Ga0068857_100019375 | 3300005577 | Bacteria | 5974 |
| 20 | Ga0068857_100378170 | 3300005577 | Bacteria | 1315 |
| 21 | Ga0068856_100186766 | 3300005614 | Bacteria | 2087 |
| 22 | Ga0068859_100877887 | 3300005617 | Bacteria | 982 |
| 23 | Ga0068864_100047695 | 3300005618 | Bacteria | 3680 |
| 24 | Ga0068864_100312083 | 3300005618 | Bacteria | 1474 |
| 25 | Ga0068863_100027293 | 3300005841 | Bacteria | 5445 |
| 26 | Ga0068863_100467180 | 3300005841 | Bacteria | 1240 |
| 27 | Ga0081455_10000005 | 3300005937 | Bacteria | 327136 |
| 28 | Ga0081539_10001219 | 3300005985 | Bacteria | 45958 |
| 29 | Ga0070717_10216308 | 3300006028 | Bacteria | 1683 |
| 30 | Ga0075428_100077871 | 3300006844 | Bacteria | 3619 |
| 31 | Ga0075428_100273604 | 3300006844 | Bacteria | 1817 |
| 32 | Ga0075428_100382034 | 3300006844 | Bacteria | 1510 |
| 33 | Ga0075428_100383521 | 3300006844 | Bacteria | 1507 |
| 34 | Ga0075428_100419431 | 3300006844 | Bacteria | 1434 |
| 35 | Ga0075430_100000832 | 3300006846 | Bacteria | 24156 |
| 36 | Ga0075430_100172591 | 3300006846 | Bacteria | 1799 |
| 37 | Ga0075431_100068616 | 3300006847 | Bacteria | 3659 |
| 38 | Ga0075431_100273571 | 3300006847 | Bacteria | 1711 |
| 39 | Ga0097620_100877939 | 3300006931 | Bacteria | 982 |
| 40 | Ga0111539_10493905 | 3300009094 | Bacteria | 1425 |
| 41 | Ga0105245_10505427 | 3300009098 | Bacteria | 1225 |
| 42 | Ga0114129_10080827 | 3300009147 | Bacteria | 4518 |
| 43 | Ga0105248_10001351 | 3300009177 | Bacteria | 27318 |
| 44 | Ga0105238_10077782 | 3300009551 | Bacteria | 3308 |
| 45 | Ga0105032_102135 | 3300009979 | Bacteria | 1784 |
| 46 | Ga0105029_101110 | 3300009984 | Bacteria | 1614 |
| 47 | Ga0157369_10173213 | 3300013105 | Bacteria | 2273 |
| 48 | Ga0157372_10110344 | 3300013307 | Bacteria | 3151 |
| 49 | Ga0163163_10295095 | 3300014325 | Bacteria | 1673 |
| 50 | Ga0157379_10111148 | 3300014968 | Bacteria | 2461 |
| 51 | Ga0206353_11560754 | 3300020082 | Bacteria | 3764 |
| 52 | Ga0213875_10002722 | 3300021388 | Bacteria | 10434 |
| 53 | Ga0213875_10080430 | 3300021388 | Bacteria | 1520 |
| 54 | Ga0207688_10264680 | 3300025901 | Bacteria | 1044 |
| 55 | Ga0207705_10041757 | 3300025909 | Bacteria | 3291 |
| 56 | Ga0207707_10431763 | 3300025912 | Bacteria | 1128 |
| 57 | Ga0207657_10206043 | 3300025919 | Bacteria | 1580 |
| 58 | Ga0207649_10187849 | 3300025920 | Bacteria | 1451 |
| 59 | Ga0207652_10130100 | 3300025921 | Bacteria | 2244 |
| 60 | Ga0207694_10248904 | 3300025924 | Bacteria | 1454 |
| 61 | Ga0207706_10509416 | 3300025933 | Bacteria | 1038 |
| 62 | Ga0207711_10031193 | 3300025941 | Bacteria | 4498 |
| 63 | Ga0207661_10005614 | 3300025944 | Bacteria | 8844 |
| 64 | Ga0207661_10080596 | 3300025944 | Bacteria | 2686 |
| 65 | Ga0207679_10198973 | 3300025945 | Bacteria | 1672 |
| 66 | Ga0207667_10252391 | 3300025949 | Bacteria | 1804 |
| 67 | Ga0207678_10002021 | 3300026067 | Bacteria | 18418 |
| 68 | Ga0207678_10067382 | 3300026067 | Bacteria | 3073 |
| 69 | Ga0207708_10000045 | 3300026075 | Bacteria | 118159 |
| 70 | Ga0207708_10109394 | 3300026075 | Bacteria | 2144 |
| 71 | Ga0207702_10645128 | 3300026078 | Bacteria | 1041 |
| 72 | Ga0207641_10065681 | 3300026088 | Bacteria | 3104 |
| 73 | Ga0207674_10022119 | 3300026116 | Bacteria | 6834 |
| 74 | Ga0207674_10131181 | 3300026116 | Bacteria | 2469 |
| 75 | Ga0207683_10341856 | 3300026121 | Bacteria | 1373 |
| 76 | Ga0207683_10497644 | 3300026121 | Bacteria | 1125 |
| 77 | Ga0307515_10036108 | 3300028794 | Bacteria | 8009 |
| 78 | Ga0307511_10003181 | 3300030521 | Bacteria | 16897 |
| 79 | Ga0307512_10076355 | 3300030522 | Bacteria | 2443 |
| 80 | Ga0307512_10146930 | 3300030522 | Bacteria | 1423 |
| 81 | Ga0307508_10082928 | 3300031616 | Bacteria | 2788 |
| 82 | Ga0307405_10062548 | 3300031731 | Bacteria | 2358 |
| 83 | Ga0307413_10024237 | 3300031824 | Bacteria | 3305 |
| 84 | Ga0307518_10111353 | 3300031838 | Bacteria | 1950 |
| 85 | Ga0307410_10018042 | 3300031852 | Bacteria | 4255 |
| 86 | Ga0307410_10327490 | 3300031852 | Bacteria | 1217 |
| 87 | Ga0307410_10431504 | 3300031852 | Bacteria | 1071 |
| 88 | Ga0326468_10000082 | 3300031889 | Bacteria | 8127 |
| 89 | Ga0307406_10028891 | 3300031901 | Bacteria | 3353 |
| 90 | Ga0307407_10001782 | 3300031903 | Bacteria | 8051 |
| 91 | Ga0307412_10033404 | 3300031911 | Bacteria | 3270 |
| 92 | Ga0307412_10059813 | 3300031911 | Bacteria | 2555 |
| 93 | Ga0307409_100004016 | 3300031995 | Bacteria | 8168 |
| 94 | Ga0307409_100040008 | 3300031995 | Bacteria | 3485 |
| 95 | Ga0307409_100346735 | 3300031995 | Bacteria | 1399 |
| 96 | Ga0307416_100000442 | 3300032002 | Bacteria | 21215 |
| 97 | Ga0307416_100026613 | 3300032002 | Bacteria | 4265 |
| 98 | Ga0307414_10024581 | 3300032004 | Bacteria | 3845 |
| 99 | Ga0307415_100000018 | 3300032126 | Bacteria | 70851 |
| 100 | Ga0307415_100041203 | 3300032126 | Bacteria | 3064 |
| 101 | Ga0307507_10013232 | 3300033179 | Bacteria | 10048 |
| 102 | Ga0307507_10151300 | 3300033179 | Bacteria | 1744 |
| 103 | Ga0307510_10093269 | 3300033180 | Bacteria | 2843 |
| 104 | Ga0373937_0042017 | 3300036401 | Bacteria | 4172 |
| 105 | Ga0436364_1113921 | 3300037853 | Bacteria | 4187 |
| 106 | Ga0436364_1379501 | 3300037853 | Bacteria | 33162 |
| 107 | Ga0466972_0008199 | 3300044658 | Bacteria | 5238 |
| 108 | Ga0466966_0012844 | 3300044684 | Bacteria | 5545 |
| 109 | Ga0466966_0155795 | 3300044684 | Bacteria | 1392 |
| 110 | Ga0466966_0164622 | 3300044684 | Bacteria | 1349 |
| 111 | Ga0466961_0000976 | 3300044693 | Bacteria | 17740 |
| 112 | Ga0466961_0074122 | 3300044693 | Bacteria | 2158 |
| 113 | Ga0466968_0032659 | 3300044735 | Bacteria | 2166 |
| 114 | Ga0466970_0249976 | 3300044765 | Bacteria | 993 |
| 115 | Ga0466959_0046791 | 3300045049 | Bacteria | 3183 |
| 116 | Ga0466967_0125240 | 3300045976 | Bacteria | 2379 |
| 117 | Ga0466967_0397934 | 3300045976 | Bacteria | 1340 |
| 118 | Ga0466967_0683332 | 3300045976 | Bacteria | 1016 |
| 119 | Ga0495639_0142944 | 3300046475 | Bacteria | 1151 |
| 120 | Ga0496104_0012301 | 3300048907 | Bacteria | 7693 |
| 121 | Ga0496105_0019033 | 3300048908 | Bacteria | 5533 |
| 122 | Ga0496108_0061169 | 3300048911 | Bacteria | 3168 |
| 123 | Ga0496108_0289135 | 3300048911 | Bacteria | 1427 |
| 124 | Ga0496109_0077989 | 3300048912 | Bacteria | 3049 |
| 125 | Ga0496109_0368505 | 3300048912 | Bacteria | 1357 |
| 126 | Ga0496110_0255081 | 3300048913 | Bacteria | 1596 |
| 127 | Ga0496111_0050012 | 3300048914 | Bacteria | 3014 |
| 128 | Ga0496112_0036055 | 3300048915 | Bacteria | 4822 |
| 129 | Ga0496126_0000267 | 3300048929 | Bacteria | 110994 |
| 130 | Ga0501047_0081226 | 3300049581 | Bacteria | 3116 |
| 131 | Ga0501075_0427523 | 3300049591 | Bacteria | 1010 |
| 132 | Ga0501076_0036490 | 3300049592 | Bacteria | 3852 |
| 133 | nmdc:mga09592_472099_c1 | 3300050508 | Bacteria | 1081 |
| 134 | nmdc:mga0qj67_108281_c1 | 3300050509 | Bacteria | 2242 |
| 135 | nmdc:mga0qj67_500395_c1 | 3300050509 | Bacteria | 977 |
| 136 | nmdc:mga0qj67_506630_c1 | 3300050509 | Bacteria | 970 |
| 137 | nmdc:mga0qj67_776_c1 | 3300050509 | Bacteria | 21723 |
| 138 | nmdc:mga06r32_248329_c1 | 3300050510 | Bacteria | 1767 |
| 139 | nmdc:mga06r32_66496_c1 | 3300050510 | Bacteria | 3478 |
| 140 | Ga0495619_0033042 | 3300053085 | Bacteria | 3359 |
| 141 | Ga0500644_0154687 | 3300053088 | Bacteria | 922 |
| 142 | Ga0500559_0001824 | 3300053136 | Bacteria | 11624 |
| 143 | Ga0501084_0379994 | 3300054114 | Bacteria | 1194 |
| 144 | 2559429318 | 2558860280 | Bacteria | 11429938 |
| 145 | 2583150572 | 2582580736 | Bacteria | 5325865 |
| 146 | 2586058572 | 2585427649 | Bacteria | 9053857 |
| 147 | 2753072591 | 2751185734 | Bacteria | 8863695 |
| 148 | 2791910836 | 2791354901 | Bacteria | 8322202 |
| 149 | 2795783831 | 2795385470 | Bacteria | 8317180 |
| 150 | 2809592582 | 2808606522 | Bacteria | 9488490 |
| 151 | 2816505147 | 2816332139 | Bacteria | 9138787 |
| 152 | 2863070843 | 2863067949 | Bacteria | 8541735 |
| 153 | 2866555208 | 2866552031 | Bacteria | 5824618 |
| 154 | 2866613682 | 2866612099 | Bacteria | 7543886 |
| 155 | 2870726956 | 2870721527 | Bacteria | 9689237 |
| 156 | 2899367634 | 2899359706 | Bacteria | 10940472 |
| 157 | 2899373546 | 2899370129 | Bacteria | 6781179 |
| 158 | 2915774473 | 2915768154 | Bacteria | 8424322 |
| 159 | 2917742030 | 2917736166 | Bacteria | 9690793 |
| 160 | 8003318420 | 8003314358 | Bacteria | 10575343 |
| 161 | 8047715325 | 8047710418 | Bacteria | 11023148 |
| 162 | 8056211768 | 8056207758 | Bacteria | 8639239 |
| 163 | nmdc:mga05p37_668009_c1 | |||
| 164 | JGI25406J46586_10018657 | |||
| 165 | Ga0070658_10004462 | |||
| 166 | Ga0070683_100015389 | |||
| 167 | Ga0070680_100196683 | |||
| 168 | Ga0070682_100029036 | |||
| 169 | Ga0070661_100066664 | |||
| 170 | Ga0070668_100005783 | |||
| 171 | Ga0070659_100044970 | |||
| 172 | Ga0070714_100010686 | |||
| 173 | Ga0070700_100000032 | |||
| 174 | Ga0070663_100000669 | |||
| 175 | Ga0070663_100076867 | |||
| 176 | Ga0070681_10331626 | |||
| 177 | Ga0070679_100029351 | |||
| 178 | Ga0070684_100131546 | |||
| 179 | Ga0070684_100164407 | |||
| 180 | Ga0070664_100074942 | |||
| 181 | Ga0068857_100019375 | |||
| 182 | Ga0068857_100378170 | |||
| 183 | Ga0068856_100186766 | |||
| 184 | Ga0068859_100877887 | |||
| 185 | Ga0068864_100047695 | |||
| 186 | Ga0068864_100312083 | |||
| 187 | Ga0068863_100027293 | |||
| 188 | Ga0068863_100467180 | |||
| 189 | Ga0081455_10000005 | |||
| 190 | Ga0081539_10001219 | |||
| 191 | Ga0070717_10216308 | |||
| 192 | Ga0075428_100077871 | |||
| 193 | Ga0075428_100273604 | |||
| 194 | Ga0075428_100382034 | |||
| 195 | Ga0075428_100383521 | |||
| 196 | Ga0075428_100419431 | |||
| 197 | Ga0075430_100000832 | |||
| 198 | Ga0075430_100172591 | |||
| 199 | Ga0075431_100068616 | |||
| 200 | Ga0075431_100273571 | |||
| 201 | Ga0097620_100877939 | |||
| 202 | Ga0111539_10493905 | |||
| 203 | Ga0105245_10505427 | |||
| 204 | Ga0114129_10080827 | |||
| 205 | Ga0105248_10001351 | |||
| 206 | Ga0105238_10077782 | |||
| 207 | Ga0105032_102135 | |||
| 208 | Ga0105029_101110 | |||
| 209 | Ga0157369_10173213 | |||
| 210 | Ga0157372_10110344 | |||
| 211 | Ga0163163_10295095 | |||
| 212 | Ga0157379_10111148 | |||
| 213 | Ga0206353_11560754 | |||
| 214 | Ga0213875_10002722 | |||
| 215 | Ga0213875_10080430 | |||
| 216 | Ga0207688_10264680 | |||
| 217 | Ga0207705_10041757 | |||
| 218 | Ga0207707_10431763 | |||
| 219 | Ga0207657_10206043 | |||
| 220 | Ga0207649_10187849 | |||
| 221 | Ga0207652_10130100 | |||
| 222 | Ga0207694_10248904 | |||
| 223 | Ga0207706_10509416 | |||
| 224 | Ga0207711_10031193 | |||
| 225 | Ga0207661_10005614 | |||
| 226 | Ga0207661_10080596 | |||
| 227 | Ga0207679_10198973 | |||
| 228 | Ga0207667_10252391 | |||
| 229 | Ga0207678_10002021 | |||
| 230 | Ga0207678_10067382 | |||
| 231 | Ga0207708_10000045 | |||
| 232 | Ga0207708_10109394 | |||
| 233 | Ga0207702_10645128 | |||
| 234 | Ga0207641_10065681 | |||
| 235 | Ga0207674_10022119 | |||
| 236 | Ga0207674_10131181 | |||
| 237 | Ga0207683_10341856 | |||
| 238 | Ga0207683_10497644 | |||
| 239 | Ga0307515_10036108 | |||
| 240 | Ga0307511_10003181 | |||
| 241 | Ga0307512_10076355 | |||
| 242 | Ga0307512_10146930 | |||
| 243 | Ga0307508_10082928 | |||
| 244 | Ga0307405_10062548 | |||
| 245 | Ga0307413_10024237 | |||
| 246 | Ga0307518_10111353 | |||
| 247 | Ga0307410_10018042 | |||
| 248 | Ga0307410_10327490 | |||
| 249 | Ga0307410_10431504 | |||
| 250 | Ga0326468_10000082 | |||
| 251 | Ga0307406_10028891 | |||
| 252 | Ga0307407_10001782 | |||
| 253 | Ga0307412_10033404 | |||
| 254 | Ga0307412_10059813 | |||
| 255 | Ga0307409_100004016 | |||
| 256 | Ga0307409_100040008 | |||
| 257 | Ga0307409_100346735 | |||
| 258 | Ga0307416_100000442 | |||
| 259 | Ga0307416_100026613 | |||
| 260 | Ga0307414_10024581 | |||
| 261 | Ga0307415_100000018 | |||
| 262 | Ga0307415_100041203 | |||
| 263 | Ga0307507_10013232 | |||
| 264 | Ga0307507_10151300 | |||
| 265 | Ga0307510_10093269 | |||
| 266 | Ga0373937_0042017 | |||
| 267 | Ga0436364_1113921 | |||
| 268 | Ga0436364_1379501 | |||
| 269 | Ga0466972_0008199 | |||
| 270 | Ga0466966_0012844 | |||
| 271 | Ga0466966_0155795 | |||
| 272 | Ga0466966_0164622 | |||
| 273 | Ga0466961_0000976 | |||
| 274 | Ga0466961_0074122 | |||
| 275 | Ga0466968_0032659 | |||
| 276 | Ga0466970_0249976 | |||
| 277 | Ga0466959_0046791 | |||
| 278 | Ga0466967_0125240 | |||
| 279 | Ga0466967_0397934 | |||
| 280 | Ga0466967_0683332 | |||
| 281 | Ga0495639_0142944 | |||
| 282 | Ga0496104_0012301 | |||
| 283 | Ga0496105_0019033 | |||
| 284 | Ga0496108_0061169 | |||
| 285 | Ga0496108_0289135 | |||
| 286 | Ga0496109_0077989 | |||
| 287 | Ga0496109_0368505 | |||
| 288 | Ga0496110_0255081 | |||
| 289 | Ga0496111_0050012 | |||
| 290 | Ga0496112_0036055 | |||
| 291 | Ga0496126_0000267 | |||
| 292 | Ga0501047_0081226 | |||
| 293 | Ga0501075_0427523 | |||
| 294 | Ga0501076_0036490 | |||
| 295 | nmdc:mga09592_472099_c1 | |||
| 296 | nmdc:mga0qj67_108281_c1 | |||
| 297 | nmdc:mga0qj67_500395_c1 | |||
| 298 | nmdc:mga0qj67_506630_c1 | |||
| 299 | nmdc:mga0qj67_776_c1 | |||
| 300 | nmdc:mga06r32_248329_c1 | |||
| 301 | nmdc:mga06r32_66496_c1 | |||
| 302 | Ga0495619_0033042 | |||
| 303 | Ga0500644_0154687 | |||
| 304 | Ga0500559_0001824 | |||
| 305 | Ga0501084_0379994 | |||
| 306 | 2559429318 | |||
| 307 | 2583150572 | |||
| 308 | 2586058572 | |||
| 309 | 2753072591 | |||
| 310 | 2791910836 | |||
| 311 | 2795783831 | |||
| 312 | 2809592582 | |||
| 313 | 2816505147 | |||
| 314 | 2863070843 | |||
| 315 | 2866555208 | |||
| 316 | 2866613682 | |||
| 317 | 2870726956 | |||
| 318 | 2899367634 | |||
| 319 | 2899373546 | |||
| 320 | 2915774473 | |||
| 321 | 2917742030 | |||
| 322 | 8003318420 | |||
| 323 | 8047715325 | |||
| 324 | 8056211768 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1t43-assembly1.cif.gz_A | crystal structure analysis of e.coli protein (n5)-glutamine methyltransferase (hemk) | 0.9012 | 7 | 279 |
| 1sg9-assembly2.cif.gz_B | crystal structure of thermotoga maritima protein hemk, an n5-glutamine methyltransferase | 0.8916 | 6 | 280 |
| 1t43-assembly1.cif.gz_A | crystal structure analysis of e.coli protein (n5)-glutamine methyltransferase (hemk) | 0.8886 | 7 | 279 |
| 1nv9-assembly1.cif.gz_A | hemk, apo structure | 0.8863 | 6 | 277 |
| 1vq1-assembly1.cif.gz_A | crystal structure of n5-glutamine methyltransferase, hemk(ec 2.1.1.-) (tm0488) from thermotoga maritima at 2.80 a resolution | 0.8785 | 4 | 277 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WHV3_1_82_1.10.8.10 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain | 0.9669 | 4 | 85 | 1.10.8.10 |
| af_P9WHV3_1_82_1.10.8.10 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain | 0.9555 | 4 | 85 | 1.10.8.10 |
| af_P9WHV3_83_284_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9489 | 87 | 280 | 3.40.50.150 |
| af_F1QJH5_134_342_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9331 | 87 | 280 | 3.40.50.150 |
| af_Q9Y5R4_126_337_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9257 | 89 | 281 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A420EWK7-F1-model_v4 | Release factor glutamine methyltransferase (RF MTase) (EC 2.1.1.297) (N5-glutamine methyltransferase PrmC) (Protein-(glutamine-N5) MTase PrmC) (Protein-glutamine N-methyltransferase PrmC) | 0.9805 | 2 | 280 |
GO:0003676
GO:0032259 GO:0036009 GO:0102559 |
| AF-A0A829QAK1-F1-model_v4 | peptide chain release factor N(5)-glutamine methyltransferase (EC 2.1.1.297) | 0.9774 | 4 | 243 |
GO:0003676
GO:0008170 GO:0008276 GO:0008757 GO:0032259 |
| AF-D6ZDA6-F1-model_v4 | Release factor glutamine methyltransferase (RF MTase) (EC 2.1.1.297) (N5-glutamine methyltransferase PrmC) (Protein-(glutamine-N5) MTase PrmC) (Protein-glutamine N-methyltransferase PrmC) | 0.9764 | 5 | 281 |
GO:0003676
GO:0032259 GO:0036009 GO:0102559 |
| AF-A0A562V3I1-F1-model_v4 | Release factor glutamine methyltransferase (RF MTase) (EC 2.1.1.297) (N5-glutamine methyltransferase PrmC) (Protein-(glutamine-N5) MTase PrmC) (Protein-glutamine N-methyltransferase PrmC) | 0.975 | 4 | 281 |
GO:0003676
GO:0032259 GO:0036009 GO:0102559 |
| AF-A0A7I7MMR3-F1-model_v4 | Release factor glutamine methyltransferase (RF MTase) (EC 2.1.1.297) (N5-glutamine methyltransferase PrmC) (Protein-(glutamine-N5) MTase PrmC) (Protein-glutamine N-methyltransferase PrmC) | 0.9726 | 6 | 280 |
GO:0003676
GO:0032259 GO:0036009 GO:0102559 |