F240352

General Info

Members Datasets Scaffolds Average Seq Length
162 124 324 287

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_668009_c1|nmdc:mga05p37_668009_c1_23_958
Length 311
Sequence MMTARRDRAAMPHDYGVSPTVEDTPEDELLDTTRVIGRAVGVLSAAGVGSPRVDAELIAAHVLGVPRGRLALSPEMTRPQARRFRELVARRAERVPLQHLLGTAPFYGLEIPVGPGVFVPRPETELLVEWGLRVLPAGTVTVVDLCSGSGAIALAVVRERPQARVYAVERDPAALEWLRRNASGHPVEVVAGDATDPTVLSTLDGQVDLVLCNPPYVRAGTPVAPEVGRHDPYPAVFAGPDGLDVIAPLVPRVARLLKRGGWFGVEHDDSHRTAVPALLRANGCFTDVADHDDLARRPRFATARRLADCIP

Samples

Sample ID Description Type Environment
1 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
35 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
40 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
42 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
61 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
62 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
63 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
64 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
65 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
66 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
67 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
68 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
69 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
70 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
71 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
72 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
75 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
76 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
77 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
78 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
80 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
81 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
82 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
83 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
84 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
85 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
86 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
87 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
88 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
89 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
90 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
91 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
92 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
93 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
94 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
95 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
96 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
98 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
99 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
100 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
101 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
102 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
103 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
104 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
105 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
106 2558860280 Kutzneria sp. 744 Isolate Unclassified
107 2582580736 Prauserella sp. Am3 Isolate Unclassified
108 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
109 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
110 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
111 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
112 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
113 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
114 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
115 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
116 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
117 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
118 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
119 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
120 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
121 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
122 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
123 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
124 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.65
Metatranscriptomes 0.62
Isolates 11.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.23
Nodule 0
Rhizoplane 5.56
Rhizosphere 76.54
Stem 0
Stem Tuber 0.62
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga05p37_668009_c1 3300050507 Bacteria 1160
2 JGI25406J46586_10018657 3300003203 Bacteria 2847
3 Ga0070658_10004462 3300005327 Bacteria 11395
4 Ga0070683_100015389 3300005329 Bacteria 6719
5 Ga0070680_100196683 3300005336 Bacteria 1700
6 Ga0070682_100029036 3300005337 Bacteria 3329
7 Ga0070661_100066664 3300005344 Bacteria 2645
8 Ga0070668_100005783 3300005347 Bacteria 9173
9 Ga0070659_100044970 3300005366 Bacteria 3459
10 Ga0070714_100010686 3300005435 Bacteria 7265
11 Ga0070700_100000032 3300005441 Bacteria 114995
12 Ga0070663_100000669 3300005455 Bacteria 18399
13 Ga0070663_100076867 3300005455 Bacteria 2443
14 Ga0070681_10331626 3300005458 Bacteria 1431
15 Ga0070679_100029351 3300005530 Bacteria 5427
16 Ga0070684_100131546 3300005535 Bacteria 2257
17 Ga0070684_100164407 3300005535 Bacteria 2014
18 Ga0070664_100074942 3300005564 Bacteria 2905
19 Ga0068857_100019375 3300005577 Bacteria 5974
20 Ga0068857_100378170 3300005577 Bacteria 1315
21 Ga0068856_100186766 3300005614 Bacteria 2087
22 Ga0068859_100877887 3300005617 Bacteria 982
23 Ga0068864_100047695 3300005618 Bacteria 3680
24 Ga0068864_100312083 3300005618 Bacteria 1474
25 Ga0068863_100027293 3300005841 Bacteria 5445
26 Ga0068863_100467180 3300005841 Bacteria 1240
27 Ga0081455_10000005 3300005937 Bacteria 327136
28 Ga0081539_10001219 3300005985 Bacteria 45958
29 Ga0070717_10216308 3300006028 Bacteria 1683
30 Ga0075428_100077871 3300006844 Bacteria 3619
31 Ga0075428_100273604 3300006844 Bacteria 1817
32 Ga0075428_100382034 3300006844 Bacteria 1510
33 Ga0075428_100383521 3300006844 Bacteria 1507
34 Ga0075428_100419431 3300006844 Bacteria 1434
35 Ga0075430_100000832 3300006846 Bacteria 24156
36 Ga0075430_100172591 3300006846 Bacteria 1799
37 Ga0075431_100068616 3300006847 Bacteria 3659
38 Ga0075431_100273571 3300006847 Bacteria 1711
39 Ga0097620_100877939 3300006931 Bacteria 982
40 Ga0111539_10493905 3300009094 Bacteria 1425
41 Ga0105245_10505427 3300009098 Bacteria 1225
42 Ga0114129_10080827 3300009147 Bacteria 4518
43 Ga0105248_10001351 3300009177 Bacteria 27318
44 Ga0105238_10077782 3300009551 Bacteria 3308
45 Ga0105032_102135 3300009979 Bacteria 1784
46 Ga0105029_101110 3300009984 Bacteria 1614
47 Ga0157369_10173213 3300013105 Bacteria 2273
48 Ga0157372_10110344 3300013307 Bacteria 3151
49 Ga0163163_10295095 3300014325 Bacteria 1673
50 Ga0157379_10111148 3300014968 Bacteria 2461
51 Ga0206353_11560754 3300020082 Bacteria 3764
52 Ga0213875_10002722 3300021388 Bacteria 10434
53 Ga0213875_10080430 3300021388 Bacteria 1520
54 Ga0207688_10264680 3300025901 Bacteria 1044
55 Ga0207705_10041757 3300025909 Bacteria 3291
56 Ga0207707_10431763 3300025912 Bacteria 1128
57 Ga0207657_10206043 3300025919 Bacteria 1580
58 Ga0207649_10187849 3300025920 Bacteria 1451
59 Ga0207652_10130100 3300025921 Bacteria 2244
60 Ga0207694_10248904 3300025924 Bacteria 1454
61 Ga0207706_10509416 3300025933 Bacteria 1038
62 Ga0207711_10031193 3300025941 Bacteria 4498
63 Ga0207661_10005614 3300025944 Bacteria 8844
64 Ga0207661_10080596 3300025944 Bacteria 2686
65 Ga0207679_10198973 3300025945 Bacteria 1672
66 Ga0207667_10252391 3300025949 Bacteria 1804
67 Ga0207678_10002021 3300026067 Bacteria 18418
68 Ga0207678_10067382 3300026067 Bacteria 3073
69 Ga0207708_10000045 3300026075 Bacteria 118159
70 Ga0207708_10109394 3300026075 Bacteria 2144
71 Ga0207702_10645128 3300026078 Bacteria 1041
72 Ga0207641_10065681 3300026088 Bacteria 3104
73 Ga0207674_10022119 3300026116 Bacteria 6834
74 Ga0207674_10131181 3300026116 Bacteria 2469
75 Ga0207683_10341856 3300026121 Bacteria 1373
76 Ga0207683_10497644 3300026121 Bacteria 1125
77 Ga0307515_10036108 3300028794 Bacteria 8009
78 Ga0307511_10003181 3300030521 Bacteria 16897
79 Ga0307512_10076355 3300030522 Bacteria 2443
80 Ga0307512_10146930 3300030522 Bacteria 1423
81 Ga0307508_10082928 3300031616 Bacteria 2788
82 Ga0307405_10062548 3300031731 Bacteria 2358
83 Ga0307413_10024237 3300031824 Bacteria 3305
84 Ga0307518_10111353 3300031838 Bacteria 1950
85 Ga0307410_10018042 3300031852 Bacteria 4255
86 Ga0307410_10327490 3300031852 Bacteria 1217
87 Ga0307410_10431504 3300031852 Bacteria 1071
88 Ga0326468_10000082 3300031889 Bacteria 8127
89 Ga0307406_10028891 3300031901 Bacteria 3353
90 Ga0307407_10001782 3300031903 Bacteria 8051
91 Ga0307412_10033404 3300031911 Bacteria 3270
92 Ga0307412_10059813 3300031911 Bacteria 2555
93 Ga0307409_100004016 3300031995 Bacteria 8168
94 Ga0307409_100040008 3300031995 Bacteria 3485
95 Ga0307409_100346735 3300031995 Bacteria 1399
96 Ga0307416_100000442 3300032002 Bacteria 21215
97 Ga0307416_100026613 3300032002 Bacteria 4265
98 Ga0307414_10024581 3300032004 Bacteria 3845
99 Ga0307415_100000018 3300032126 Bacteria 70851
100 Ga0307415_100041203 3300032126 Bacteria 3064
101 Ga0307507_10013232 3300033179 Bacteria 10048
102 Ga0307507_10151300 3300033179 Bacteria 1744
103 Ga0307510_10093269 3300033180 Bacteria 2843
104 Ga0373937_0042017 3300036401 Bacteria 4172
105 Ga0436364_1113921 3300037853 Bacteria 4187
106 Ga0436364_1379501 3300037853 Bacteria 33162
107 Ga0466972_0008199 3300044658 Bacteria 5238
108 Ga0466966_0012844 3300044684 Bacteria 5545
109 Ga0466966_0155795 3300044684 Bacteria 1392
110 Ga0466966_0164622 3300044684 Bacteria 1349
111 Ga0466961_0000976 3300044693 Bacteria 17740
112 Ga0466961_0074122 3300044693 Bacteria 2158
113 Ga0466968_0032659 3300044735 Bacteria 2166
114 Ga0466970_0249976 3300044765 Bacteria 993
115 Ga0466959_0046791 3300045049 Bacteria 3183
116 Ga0466967_0125240 3300045976 Bacteria 2379
117 Ga0466967_0397934 3300045976 Bacteria 1340
118 Ga0466967_0683332 3300045976 Bacteria 1016
119 Ga0495639_0142944 3300046475 Bacteria 1151
120 Ga0496104_0012301 3300048907 Bacteria 7693
121 Ga0496105_0019033 3300048908 Bacteria 5533
122 Ga0496108_0061169 3300048911 Bacteria 3168
123 Ga0496108_0289135 3300048911 Bacteria 1427
124 Ga0496109_0077989 3300048912 Bacteria 3049
125 Ga0496109_0368505 3300048912 Bacteria 1357
126 Ga0496110_0255081 3300048913 Bacteria 1596
127 Ga0496111_0050012 3300048914 Bacteria 3014
128 Ga0496112_0036055 3300048915 Bacteria 4822
129 Ga0496126_0000267 3300048929 Bacteria 110994
130 Ga0501047_0081226 3300049581 Bacteria 3116
131 Ga0501075_0427523 3300049591 Bacteria 1010
132 Ga0501076_0036490 3300049592 Bacteria 3852
133 nmdc:mga09592_472099_c1 3300050508 Bacteria 1081
134 nmdc:mga0qj67_108281_c1 3300050509 Bacteria 2242
135 nmdc:mga0qj67_500395_c1 3300050509 Bacteria 977
136 nmdc:mga0qj67_506630_c1 3300050509 Bacteria 970
137 nmdc:mga0qj67_776_c1 3300050509 Bacteria 21723
138 nmdc:mga06r32_248329_c1 3300050510 Bacteria 1767
139 nmdc:mga06r32_66496_c1 3300050510 Bacteria 3478
140 Ga0495619_0033042 3300053085 Bacteria 3359
141 Ga0500644_0154687 3300053088 Bacteria 922
142 Ga0500559_0001824 3300053136 Bacteria 11624
143 Ga0501084_0379994 3300054114 Bacteria 1194
144 2559429318 2558860280 Bacteria 11429938
145 2583150572 2582580736 Bacteria 5325865
146 2586058572 2585427649 Bacteria 9053857
147 2753072591 2751185734 Bacteria 8863695
148 2791910836 2791354901 Bacteria 8322202
149 2795783831 2795385470 Bacteria 8317180
150 2809592582 2808606522 Bacteria 9488490
151 2816505147 2816332139 Bacteria 9138787
152 2863070843 2863067949 Bacteria 8541735
153 2866555208 2866552031 Bacteria 5824618
154 2866613682 2866612099 Bacteria 7543886
155 2870726956 2870721527 Bacteria 9689237
156 2899367634 2899359706 Bacteria 10940472
157 2899373546 2899370129 Bacteria 6781179
158 2915774473 2915768154 Bacteria 8424322
159 2917742030 2917736166 Bacteria 9690793
160 8003318420 8003314358 Bacteria 10575343
161 8047715325 8047710418 Bacteria 11023148
162 8056211768 8056207758 Bacteria 8639239
163 nmdc:mga05p37_668009_c1
164 JGI25406J46586_10018657
165 Ga0070658_10004462
166 Ga0070683_100015389
167 Ga0070680_100196683
168 Ga0070682_100029036
169 Ga0070661_100066664
170 Ga0070668_100005783
171 Ga0070659_100044970
172 Ga0070714_100010686
173 Ga0070700_100000032
174 Ga0070663_100000669
175 Ga0070663_100076867
176 Ga0070681_10331626
177 Ga0070679_100029351
178 Ga0070684_100131546
179 Ga0070684_100164407
180 Ga0070664_100074942
181 Ga0068857_100019375
182 Ga0068857_100378170
183 Ga0068856_100186766
184 Ga0068859_100877887
185 Ga0068864_100047695
186 Ga0068864_100312083
187 Ga0068863_100027293
188 Ga0068863_100467180
189 Ga0081455_10000005
190 Ga0081539_10001219
191 Ga0070717_10216308
192 Ga0075428_100077871
193 Ga0075428_100273604
194 Ga0075428_100382034
195 Ga0075428_100383521
196 Ga0075428_100419431
197 Ga0075430_100000832
198 Ga0075430_100172591
199 Ga0075431_100068616
200 Ga0075431_100273571
201 Ga0097620_100877939
202 Ga0111539_10493905
203 Ga0105245_10505427
204 Ga0114129_10080827
205 Ga0105248_10001351
206 Ga0105238_10077782
207 Ga0105032_102135
208 Ga0105029_101110
209 Ga0157369_10173213
210 Ga0157372_10110344
211 Ga0163163_10295095
212 Ga0157379_10111148
213 Ga0206353_11560754
214 Ga0213875_10002722
215 Ga0213875_10080430
216 Ga0207688_10264680
217 Ga0207705_10041757
218 Ga0207707_10431763
219 Ga0207657_10206043
220 Ga0207649_10187849
221 Ga0207652_10130100
222 Ga0207694_10248904
223 Ga0207706_10509416
224 Ga0207711_10031193
225 Ga0207661_10005614
226 Ga0207661_10080596
227 Ga0207679_10198973
228 Ga0207667_10252391
229 Ga0207678_10002021
230 Ga0207678_10067382
231 Ga0207708_10000045
232 Ga0207708_10109394
233 Ga0207702_10645128
234 Ga0207641_10065681
235 Ga0207674_10022119
236 Ga0207674_10131181
237 Ga0207683_10341856
238 Ga0207683_10497644
239 Ga0307515_10036108
240 Ga0307511_10003181
241 Ga0307512_10076355
242 Ga0307512_10146930
243 Ga0307508_10082928
244 Ga0307405_10062548
245 Ga0307413_10024237
246 Ga0307518_10111353
247 Ga0307410_10018042
248 Ga0307410_10327490
249 Ga0307410_10431504
250 Ga0326468_10000082
251 Ga0307406_10028891
252 Ga0307407_10001782
253 Ga0307412_10033404
254 Ga0307412_10059813
255 Ga0307409_100004016
256 Ga0307409_100040008
257 Ga0307409_100346735
258 Ga0307416_100000442
259 Ga0307416_100026613
260 Ga0307414_10024581
261 Ga0307415_100000018
262 Ga0307415_100041203
263 Ga0307507_10013232
264 Ga0307507_10151300
265 Ga0307510_10093269
266 Ga0373937_0042017
267 Ga0436364_1113921
268 Ga0436364_1379501
269 Ga0466972_0008199
270 Ga0466966_0012844
271 Ga0466966_0155795
272 Ga0466966_0164622
273 Ga0466961_0000976
274 Ga0466961_0074122
275 Ga0466968_0032659
276 Ga0466970_0249976
277 Ga0466959_0046791
278 Ga0466967_0125240
279 Ga0466967_0397934
280 Ga0466967_0683332
281 Ga0495639_0142944
282 Ga0496104_0012301
283 Ga0496105_0019033
284 Ga0496108_0061169
285 Ga0496108_0289135
286 Ga0496109_0077989
287 Ga0496109_0368505
288 Ga0496110_0255081
289 Ga0496111_0050012
290 Ga0496112_0036055
291 Ga0496126_0000267
292 Ga0501047_0081226
293 Ga0501075_0427523
294 Ga0501076_0036490
295 nmdc:mga09592_472099_c1
296 nmdc:mga0qj67_108281_c1
297 nmdc:mga0qj67_500395_c1
298 nmdc:mga0qj67_506630_c1
299 nmdc:mga0qj67_776_c1
300 nmdc:mga06r32_248329_c1
301 nmdc:mga06r32_66496_c1
302 Ga0495619_0033042
303 Ga0500644_0154687
304 Ga0500559_0001824
305 Ga0501084_0379994
306 2559429318
307 2583150572
308 2586058572
309 2753072591
310 2791910836
311 2795783831
312 2809592582
313 2816505147
314 2863070843
315 2866555208
316 2866613682
317 2870726956
318 2899367634
319 2899373546
320 2915774473
321 2917742030
322 8003318420
323 8047715325
324 8056211768

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17827

PrmC_N

PrmC N-terminal domain

35

102

0.96

PF13649

Methyltransf_25

Methyltransferase domain

142

224

0.92

PF08241

Methyltransf_11

Methyltransferase domain

143

214

0.9

PF05175

MTS

Methyltransferase small domain

115

229

0.86

PF02475

Met_10

Met-10+ like-protein

133

217

0.84

PF03602

Cons_hypoth95

Conserved hypothetical protein 95

132

227

0.8

PF01728

FtsJ

FtsJ-like methyltransferase

125

289

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
1t43-assembly1.cif.gz_A crystal structure analysis of e.coli protein (n5)-glutamine methyltransferase (hemk) 0.9012 7 279
1sg9-assembly2.cif.gz_B crystal structure of thermotoga maritima protein hemk, an n5-glutamine methyltransferase 0.8916 6 280
1t43-assembly1.cif.gz_A crystal structure analysis of e.coli protein (n5)-glutamine methyltransferase (hemk) 0.8886 7 279
1nv9-assembly1.cif.gz_A hemk, apo structure 0.8863 6 277
1vq1-assembly1.cif.gz_A crystal structure of n5-glutamine methyltransferase, hemk(ec 2.1.1.-) (tm0488) from thermotoga maritima at 2.80 a resolution 0.8785 4 277
ID Description Score Start End Superfamily
af_P9WHV3_1_82_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.9669 4 85 1.10.8.10
af_P9WHV3_1_82_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.9555 4 85 1.10.8.10
af_P9WHV3_83_284_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9489 87 280 3.40.50.150
af_F1QJH5_134_342_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9331 87 280 3.40.50.150
af_Q9Y5R4_126_337_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9257 89 281 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A420EWK7-F1-model_v4 Release factor glutamine methyltransferase (RF MTase) (EC 2.1.1.297) (N5-glutamine methyltransferase PrmC) (Protein-(glutamine-N5) MTase PrmC) (Protein-glutamine N-methyltransferase PrmC) 0.9805 2 280 GO:0003676
GO:0032259
GO:0036009
GO:0102559
AF-A0A829QAK1-F1-model_v4 peptide chain release factor N(5)-glutamine methyltransferase (EC 2.1.1.297) 0.9774 4 243 GO:0003676
GO:0008170
GO:0008276
GO:0008757
GO:0032259
AF-D6ZDA6-F1-model_v4 Release factor glutamine methyltransferase (RF MTase) (EC 2.1.1.297) (N5-glutamine methyltransferase PrmC) (Protein-(glutamine-N5) MTase PrmC) (Protein-glutamine N-methyltransferase PrmC) 0.9764 5 281 GO:0003676
GO:0032259
GO:0036009
GO:0102559
AF-A0A562V3I1-F1-model_v4 Release factor glutamine methyltransferase (RF MTase) (EC 2.1.1.297) (N5-glutamine methyltransferase PrmC) (Protein-(glutamine-N5) MTase PrmC) (Protein-glutamine N-methyltransferase PrmC) 0.975 4 281 GO:0003676
GO:0032259
GO:0036009
GO:0102559
AF-A0A7I7MMR3-F1-model_v4 Release factor glutamine methyltransferase (RF MTase) (EC 2.1.1.297) (N5-glutamine methyltransferase PrmC) (Protein-(glutamine-N5) MTase PrmC) (Protein-glutamine N-methyltransferase PrmC) 0.9726 6 280 GO:0003676
GO:0032259
GO:0036009
GO:0102559

Map