F240254

General Info

Members Datasets Scaffolds Average Seq Length
162 124 162 101

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0748827|Ga0501032_0748827_198_530
Length 110
Sequence VTVQTRWVPEAIEDLRAGYDWYDERQAGLGSQLAPETFEAVAEGARFPLAHKRYEHAQLPDLPEVRKVQLGRFSEYGVIYTVVDDTFWVIAVAHAKRRPGYWADRLDTLR

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
42 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
55 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
56 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
57 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
58 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
59 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
60 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
61 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
62 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
63 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
64 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
65 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
66 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
67 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
68 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
69 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
70 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
71 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
72 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
73 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
74 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
75 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
76 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
79 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
80 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
81 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
82 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
83 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
84 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
85 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
86 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
87 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
88 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
89 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
90 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
91 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
104 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
105 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
106 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
107 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
108 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
109 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
110 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
111 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
112 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
113 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
114 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
115 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
117 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
118 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
119 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
120 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
121 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
122 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
123 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
124 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.62
Nodule 0
Rhizoplane 4.32
Rhizosphere 92.59
Stem 0
Stem Tuber 0
Unclassified 2.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10085066 3300003320 Bacteria 5069
2 Ga0070670_100050330 3300005331 Bacteria 3580
3 Ga0070680_100110301 3300005336 Unclassified 2290
4 Ga0070682_100001075 3300005337 Bacteria 15742
5 Ga0070689_100288761 3300005340 Bacteria 1362
6 Ga0070691_10323695 3300005341 Unclassified 849
7 Ga0070692_10118973 3300005345 Bacteria 1470
8 Ga0070669_100059284 3300005353 Unclassified 2811
9 Ga0070659_100651023 3300005366 Unclassified 908
10 Ga0070703_10579557 3300005406 Unclassified 515
11 Ga0070701_10766564 3300005438 Unclassified 655
12 Ga0070705_100353704 3300005440 Unclassified 1072
13 Ga0070700_100473061 3300005441 Unclassified 958
14 Ga0070694_100073989 3300005444 Bacteria 2354
15 Ga0070708_100275911 3300005445 Bacteria 1582
16 Ga0070708_100644276 3300005445 Bacteria 998
17 Ga0070662_101307412 3300005457 Unclassified 624
18 Ga0070681_10133594 3300005458 Bacteria 2413
19 Ga0070707_100160962 3300005468 Bacteria 2187
20 Ga0070699_100624047 3300005518 Bacteria 983
21 Ga0070679_100409028 3300005530 Unclassified 1302
22 Ga0070697_100020339 3300005536 Bacteria 5251
23 Ga0070697_100333709 3300005536 Bacteria 1307
24 Ga0070696_100168306 3300005546 Unclassified 1619
25 Ga0068859_100556352 3300005617 Bacteria 1241
26 Ga0068861_102368716 3300005719 Unclassified 533
27 Ga0068858_101351275 3300005842 Unclassified 702
28 Ga0097621_100576520 3300006237 Bacteria 1026
29 Ga0097621_100709663 3300006237 Bacteria 926
30 Ga0075430_100314135 3300006846 Bacteria 1296
31 Ga0075430_100477868 3300006846 Bacteria 1028
32 Ga0075434_100576898 3300006871 Bacteria 1144
33 Ga0075436_100644451 3300006914 Unclassified 782
34 Ga0097620_100556341 3300006931 Bacteria 1241
35 Ga0099794_10000459 3300007265 Bacteria 13629
36 Ga0099794_10050971 3300007265 Unclassified 1992
37 Ga0099794_10215895 3300007265 Bacteria 985
38 Ga0111539_10286885 3300009094 Unclassified 1915
39 Ga0105245_12399424 3300009098 Bacteria 581
40 Ga0105245_12899334 3300009098 Unclassified 532
41 Ga0114129_10839632 3300009147 Bacteria 1169
42 Ga0105243_11542238 3300009148 Unclassified 689
43 Ga0105249_10085957 3300009553 Bacteria 2932
44 Ga0105246_10117089 3300011119 Bacteria 1968
45 Ga0157378_10000932 3300013297 Bacteria 26977
46 Ga0163162_11001472 3300013306 Unclassified 945
47 Ga0157372_12803041 3300013307 Unclassified 559
48 Ga0213872_10135565 3300021361 Bacteria 1082
49 Ga0207653_10002747 3300025885 Bacteria 5599
50 Ga0207707_10124055 3300025912 Unclassified 2259
51 Ga0207660_10826048 3300025917 Unclassified 756
52 Ga0207652_10369135 3300025921 Unclassified 1295
53 Ga0207646_10580063 3300025922 Bacteria 1007
54 Ga0207650_10000247 3300025925 Bacteria 59104
55 Ga0207706_11084228 3300025933 Unclassified 670
56 Ga0207709_10942748 3300025935 Unclassified 703
57 Ga0207670_10832117 3300025936 Unclassified 770
58 Ga0207661_10780167 3300025944 Bacteria 880
59 Ga0207675_100294572 3300026118 Bacteria 1579
60 Ga0209588_1113085 3300027671 Bacteria 871
61 Ga0209588_1237076 3300027671 Unclassified 560
62 Ga0207428_10897164 3300027907 Unclassified 626
63 Ga0265325_10120660 3300031241 Bacteria 1264
64 Ga0307509_10045848 3300031507 Bacteria 4710
65 Ga0307408_101610913 3300031548 Unclassified 617
66 Ga0316576_10032175 3300031727 Bacteria 3727
67 Ga0316578_10019387 3300031728 Bacteria 3743
68 Ga0307516_10046560 3300031730 Bacteria 4279
69 Ga0307410_10329411 3300031852 Bacteria 1214
70 Ga0307410_11929171 3300031852 Unclassified 526
71 Ga0307407_10000081 3300031903 Bacteria 34023
72 Ga0307407_10005384 3300031903 Bacteria 5550
73 Ga0307412_10000127 3300031911 Bacteria 56113
74 Ga0307412_11914174 3300031911 Bacteria 547
75 Ga0307416_100181634 3300032002 Bacteria 1972
76 Ga0307411_10438505 3300032005 Bacteria 1089
77 Ga0373930_0018886 3300034816 Unclassified 1330
78 Ga0373928_0028848 3300035084 Bacteria 1217
79 Ga0373929_0057255 3300035085 Unclassified 905
80 Ga0373949_0014826 3300035090 Bacteria 1737
81 Ga0373939_0117508 3300035114 Unclassified 934
82 Ga0373941_0050800 3300035115 Bacteria 1317
83 Ga0373960_0218869 3300035121 Unclassified 680
84 Ga0373943_0105252 3300035170 Bacteria 1481
85 Ga0373955_0060938 3300035172 Bacteria 2083
86 Ga0373931_0025125 3300035691 Bacteria 3025
87 Ga0373937_2142073 3300036401 Unclassified 505
88 Ga0395900_0006680 3300037418 Bacteria 11985
89 Ga0395900_0063243 3300037418 Bacteria 3804
90 Ga0395901_0044848 3300038443 Bacteria 4586
91 Ga0395901_0604715 3300038443 Unclassified 1105
92 Ga0436361_0167396 3300039447 Bacteria 2251
93 Ga0451791_0131941 3300041451 Bacteria 720
94 Ga0451800_0028178 3300041459 Bacteria 844
95 Ga0451800_1257536 3300041459 Unclassified 748
96 Ga0451800_1410075 3300041459 Bacteria 1141
97 Ga0451839_0407307 3300041496 Unclassified 711
98 Ga0451577_0150165 3300042876 Bacteria 2096
99 Ga0453683_0006033 3300044673 Bacteria 8350
100 Ga0453683_0063736 3300044673 Bacteria 2304
101 Ga0453684_0216627 3300044712 Bacteria 2221
102 Ga0451576_1033779 3300045051 Bacteria 861
103 Ga0451576_1076659 3300045051 Unclassified 841
104 Ga0451576_1566079 3300045051 Bacteria 684
105 Ga0495638_0191215 3300046460 Unclassified 1161
106 Ga0496102_0034779 3300048905 Bacteria 4534
107 Ga0496103_0099436 3300048906 Bacteria 1840
108 Ga0496107_1035673 3300048910 Bacteria 595
109 Ga0501032_0748827 3300049569 Bacteria 618
110 Ga0501033_0385814 3300049570 Bacteria 978
111 Ga0501036_0163924 3300049572 Bacteria 1874
112 Ga0501036_0808610 3300049572 Unclassified 772
113 Ga0501037_0008063 3300049573 Bacteria 7716
114 Ga0501038_0245714 3300049574 Bacteria 1419
115 Ga0501039_0587950 3300049575 Bacteria 873
116 Ga0501040_0953368 3300049576 Unclassified 622
117 Ga0501042_0204809 3300049578 Unclassified 1423
118 Ga0501042_0215203 3300049578 Bacteria 1386
119 Ga0501043_0212164 3300049579 Bacteria 1500
120 Ga0501043_0836460 3300049579 Unclassified 664
121 Ga0501046_0069291 3300049580 Bacteria 2744
122 Ga0501047_0002695 3300049581 Bacteria 16914
123 Ga0501048_0046679 3300049582 Bacteria 3092
124 Ga0501048_0415935 3300049582 Unclassified 962
125 Ga0501068_0524022 3300049584 Bacteria 770
126 Ga0501070_0338889 3300049586 Unclassified 1221
127 Ga0501070_0910639 3300049586 Unclassified 686
128 Ga0501071_0254203 3300049587 Bacteria 1327
129 Ga0501072_0658188 3300049588 Bacteria 824
130 Ga0501072_0798673 3300049588 Unclassified 739
131 Ga0501072_1257999 3300049588 Unclassified 574
132 Ga0501073_0130876 3300049589 Bacteria 1739
133 Ga0501073_1154117 3300049589 Unclassified 532
134 Ga0501074_0515880 3300049590 Bacteria 847
135 Ga0501075_0132927 3300049591 Unclassified 1896
136 Ga0501076_0086674 3300049592 Bacteria 2517
137 Ga0501077_0608008 3300049593 Unclassified 702
138 Ga0501077_1048650 3300049593 Unclassified 525
139 Ga0501079_0013605 3300049741 Bacteria 6207
140 Ga0501079_0140696 3300049741 Bacteria 1880
141 Ga0501080_0811543 3300049742 Unclassified 820
142 Ga0501081_0041375 3300049743 Bacteria 3156
143 Ga0501081_0127268 3300049743 Bacteria 1818
144 Ga0501035_0003408 3300049822 Bacteria 15211
145 Ga0501044_0004718 3300049823 Bacteria 15232
146 nmdc:mga0qj67_1083764_c1 3300050509 Unclassified 626
147 nmdc:mga0qj67_497020_c1 3300050509 Bacteria 981
148 nmdc:mga08y16_1168668_c1 3300050511 Unclassified 742
149 nmdc:mga0n895_524511_c1 3300050512 Bacteria 1192
150 nmdc:mga08x19_1064177_c1 3300050514 Unclassified 574
151 Ga0500576_084977 3300053725 Bacteria 1328
152 Ga0501084_0002617 3300054114 Bacteria 14498
153 Ga0501084_0022170 3300054114 Bacteria 5299
154 Ga0501084_0179247 3300054114 Unclassified 1789
155 Ga0501084_0900142 3300054114 Bacteria 744
156 Ga0501082_0080671 3300060353 Bacteria 2808
157 Ga0501082_0290412 3300060353 Bacteria 1424
158 Ga0501082_0464790 3300060353 Unclassified 1106
159 Ga0501082_1274040 3300060353 Bacteria 642
160 Ga0501082_1660042 3300060353 Bacteria 558
161 Ga0530510_0667822 3300061734 Bacteria 791
162 Ga0530510_0885399 3300061734 Unclassified 682

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300054114 Ga0501084_0022170 Ga0501084_0022170_2990_3244 82
2 3300041459 Ga0451800_0028178 Ga0451800_0028178_132_407 87
3 3300049588 Ga0501072_0798673 Ga0501072_0798673_412_687 87
4 3300060353 Ga0501082_0464790 Ga0501082_0464790_138_413 87
5 3300031852 Ga0307410_11929171 Ga0307410_119291711 91
6 3300007265 Ga0099794_10000459 Ga0099794_100004599 92
7 3300005331 Ga0070670_100050330 Ga0070670_1000503303 93
8 3300005336 Ga0070680_100110301 Ga0070680_1001103013 94
9 3300005340 Ga0070689_100288761 Ga0070689_1002887613 94
10 3300005341 Ga0070691_10323695 Ga0070691_103236952 94
11 3300005353 Ga0070669_100059284 Ga0070669_1000592844 94
12 3300005366 Ga0070659_100651023 Ga0070659_1006510231 94
13 3300005406 Ga0070703_10579557 Ga0070703_105795572 94
14 3300005438 Ga0070701_10766564 Ga0070701_107665641 94
15 3300005440 Ga0070705_100353704 Ga0070705_1003537043 94
16 3300005441 Ga0070700_100473061 Ga0070700_1004730611 94
17 3300005444 Ga0070694_100073989 Ga0070694_1000739891 94
18 3300005445 Ga0070708_100275911 Ga0070708_1002759114 94
19 3300005445 Ga0070708_100644276 Ga0070708_1006442763 94
20 3300005457 Ga0070662_101307412 Ga0070662_1013074122 94
21 3300005458 Ga0070681_10133594 Ga0070681_101335943 94
22 3300005518 Ga0070699_100624047 Ga0070699_1006240473 94
23 3300005530 Ga0070679_100409028 Ga0070679_1004090282 94
24 3300005536 Ga0070697_100020339 Ga0070697_1000203397 94
25 3300005536 Ga0070697_100333709 Ga0070697_1003337092 94
26 3300005546 Ga0070696_100168306 Ga0070696_1001683063 94
27 3300005617 Ga0068859_100556352 Ga0068859_1005563522 94
28 3300005719 Ga0068861_102368716 Ga0068861_1023687162 94
29 3300005842 Ga0068858_101351275 Ga0068858_1013512752 94
30 3300006237 Ga0097621_100709663 Ga0097621_1007096632 94
31 3300006931 Ga0097620_100556341 Ga0097620_1005563413 94
32 3300007265 Ga0099794_10050971 Ga0099794_100509714 94
33 3300009094 Ga0111539_10286885 Ga0111539_102868852 94
34 3300009098 Ga0105245_12899334 Ga0105245_128993341 94
35 3300009148 Ga0105243_11542238 Ga0105243_115422382 94
36 3300011119 Ga0105246_10117089 Ga0105246_101170892 94
37 3300013297 Ga0157378_10000932 Ga0157378_100009323 94
38 3300013306 Ga0163162_11001472 Ga0163162_110014723 94
39 3300025912 Ga0207707_10124055 Ga0207707_101240554 94
40 3300025917 Ga0207660_10826048 Ga0207660_108260481 94
41 3300025921 Ga0207652_10369135 Ga0207652_103691352 94
42 3300025922 Ga0207646_10580063 Ga0207646_105800632 94
43 3300025925 Ga0207650_10000247 Ga0207650_100002476 94
44 3300025933 Ga0207706_11084228 Ga0207706_110842282 94
45 3300025935 Ga0207709_10942748 Ga0207709_109427482 94
46 3300025936 Ga0207670_10832117 Ga0207670_108321172 94
47 3300026118 Ga0207675_100294572 Ga0207675_1002945722 94
48 3300027671 Ga0209588_1237076 Ga0209588_12370762 94
49 3300027907 Ga0207428_10897164 Ga0207428_108971641 94
50 3300034816 Ga0373930_0018886 Ga0373930_0018886_372_668 94
51 3300035084 Ga0373928_0028848 Ga0373928_0028848_827_1123 94
52 3300035085 Ga0373929_0057255 Ga0373929_0057255_419_715 94
53 3300035114 Ga0373939_0117508 Ga0373939_0117508_281_577 94
54 3300035121 Ga0373960_0218869 Ga0373960_0218869_100_396 94
55 3300035691 Ga0373931_0025125 Ga0373931_0025125_121_417 94
56 3300045051 Ga0451576_1076659 Ga0451576_1076659_295_591 94
57 3300048905 Ga0496102_0034779 Ga0496102_0034779_4076_4372 94
58 3300048906 Ga0496103_0099436 Ga0496103_0099436_1439_1735 94
59 3300048910 Ga0496107_1035673 Ga0496107_1035673_19_315 94
60 3300050511 nmdc:mga08y16_1168668_c1 nmdc:mga08y16_1168668_c1_354_650 94
61 3300060353 Ga0501082_0290412 Ga0501082_0290412_298_594 94
62 3300061734 Ga0530510_0885399 Ga0530510_0885399_16_312 94
63 3300006914 Ga0075436_100644451 Ga0075436_1006444513 95
64 3300031241 Ga0265325_10120660 Ga0265325_101206603 95
65 3300035170 Ga0373943_0105252 Ga0373943_0105252_606_899 95
66 3300035172 Ga0373955_0060938 Ga0373955_0060938_328_621 95
67 3300036401 Ga0373937_2142073 Ga0373937_2142073_67_360 95
68 3300050514 nmdc:mga08x19_1064177_c1 nmdc:mga08x19_1064177_c1_250_543 95
69 3300021361 Ga0213872_10135565 Ga0213872_101355652 96
70 3300039447 Ga0436361_0167396 Ga0436361_0167396_219_512 96
71 3300006237 Ga0097621_100576520 Ga0097621_1005765202 97
72 3300006846 Ga0075430_100477868 Ga0075430_1004778683 97
73 3300013307 Ga0157372_12803041 Ga0157372_128030411 97
74 3300031507 Ga0307509_10045848 Ga0307509_100458482 97
75 3300031548 Ga0307408_101610913 Ga0307408_1016109131 97
76 3300031730 Ga0307516_10046560 Ga0307516_100465603 97
77 3300031852 Ga0307410_10329411 Ga0307410_103294112 97
78 3300031903 Ga0307407_10000081 Ga0307407_1000008117 97
79 3300031911 Ga0307412_10000127 Ga0307412_1000012749 97
80 3300031911 Ga0307412_11914174 Ga0307412_119141742 97
81 3300032002 Ga0307416_100181634 Ga0307416_1001816343 97
82 3300032005 Ga0307411_10438505 Ga0307411_104385052 97
83 3300037418 Ga0395900_0063243 Ga0395900_0063243_511_804 97
84 3300038443 Ga0395901_0604715 Ga0395901_0604715_683_976 97
85 3300041496 Ga0451839_0407307 Ga0451839_0407307_133_426 97
86 3300044712 Ga0453684_0216627 Ga0453684_0216627_1605_1904 97
87 3300045051 Ga0451576_1033779 Ga0451576_1033779_330_626 97
88 3300045051 Ga0451576_1566079 Ga0451576_1566079_119_415 97
89 3300050509 nmdc:mga0qj67_1083764_c1 nmdc:mga0qj67_1083764_c1_34_339 97
90 3300005337 Ga0070682_100001075 Ga0070682_1000010759 98
91 3300005468 Ga0070707_100160962 Ga0070707_1001609622 98
92 3300006846 Ga0075430_100314135 Ga0075430_1003141353 98
93 3300006871 Ga0075434_100576898 Ga0075434_1005768982 98
94 3300009098 Ga0105245_12399424 Ga0105245_123994241 98
95 3300009147 Ga0114129_10839632 Ga0114129_108396323 98
96 3300025885 Ga0207653_10002747 Ga0207653_100027471 98
97 3300025944 Ga0207661_10780167 Ga0207661_107801673 98
98 3300031903 Ga0307407_10005384 Ga0307407_100053846 98
99 3300041451 Ga0451791_0131941 Ga0451791_0131941_240_548 98
100 3300041459 Ga0451800_1257536 Ga0451800_1257536_379_687 98
101 3300041459 Ga0451800_1410075 Ga0451800_1410075_675_983 98
102 3300049576 Ga0501040_0953368 Ga0501040_0953368_249_557 98
103 3300049579 Ga0501043_0836460 Ga0501043_0836460_28_336 98
104 3300049582 Ga0501048_0415935 Ga0501048_0415935_247_555 98
105 3300049588 Ga0501072_1257999 Ga0501072_1257999_218_526 98
106 3300049589 Ga0501073_1154117 Ga0501073_1154117_90_398 98
107 3300049593 Ga0501077_0608008 Ga0501077_0608008_291_599 98
108 3300049593 Ga0501077_1048650 Ga0501077_1048650_59_373 98
109 3300049741 Ga0501079_0013605 Ga0501079_0013605_187_495 98
110 3300049743 Ga0501081_0041375 Ga0501081_0041375_45_359 98
111 3300049743 Ga0501081_0127268 Ga0501081_0127268_258_566 98
112 3300050509 nmdc:mga0qj67_497020_c1 nmdc:mga0qj67_497020_c1_450_764 98
113 3300050512 nmdc:mga0n895_524511_c1 nmdc:mga0n895_524511_c1_437_751 98
114 3300053725 Ga0500576_084977 Ga0500576_084977_869_1171 98
115 3300054114 Ga0501084_0900142 Ga0501084_0900142_344_658 98
116 3300060353 Ga0501082_1660042 Ga0501082_1660042_150_464 98
117 3300061734 Ga0530510_0667822 Ga0530510_0667822_367_675 98
118 3300007265 Ga0099794_10215895 Ga0099794_102158952 99
119 3300031727 Ga0316576_10032175 Ga0316576_100321757 99
120 3300031728 Ga0316578_10019387 Ga0316578_100193877 99
121 3300044673 Ga0453683_0006033 Ga0453683_0006033_5734_6051 99
122 3300046460 Ga0495638_0191215 Ga0495638_0191215_171_488 99
123 3300049572 Ga0501036_0808610 Ga0501036_0808610_384_701 99
124 3300049575 Ga0501039_0587950 Ga0501039_0587950_407_724 99
125 3300049578 Ga0501042_0215203 Ga0501042_0215203_465_782 99
126 3300049584 Ga0501068_0524022 Ga0501068_0524022_333_650 99
127 3300049586 Ga0501070_0910639 Ga0501070_0910639_92_409 99
128 3300049587 Ga0501071_0254203 Ga0501071_0254203_671_988 99
129 3300049590 Ga0501074_0515880 Ga0501074_0515880_10_327 99
130 3300049591 Ga0501075_0132927 Ga0501075_0132927_1257_1574 99
131 3300049592 Ga0501076_0086674 Ga0501076_0086674_119_436 99
132 3300049741 Ga0501079_0140696 Ga0501079_0140696_495_812 99
133 3300049742 Ga0501080_0811543 Ga0501080_0811543_191_508 99
134 3300054114 Ga0501084_0179247 Ga0501084_0179247_408_725 99
135 3300060353 Ga0501082_0080671 Ga0501082_0080671_1074_1391 99
136 3300027671 Ga0209588_1113085 Ga0209588_11130853 100
137 3300037418 Ga0395900_0006680 Ga0395900_0006680_10869_11171 100
138 3300038443 Ga0395901_0044848 Ga0395901_0044848_81_383 100
139 3300049569 Ga0501032_0748827 Ga0501032_0748827_198_530 100
140 3300049570 Ga0501033_0385814 Ga0501033_0385814_330_662 100
141 3300049572 Ga0501036_0163924 Ga0501036_0163924_1504_1836 100
142 3300049573 Ga0501037_0008063 Ga0501037_0008063_823_1155 100
143 3300049574 Ga0501038_0245714 Ga0501038_0245714_279_611 100
144 3300049578 Ga0501042_0204809 Ga0501042_0204809_351_683 100
145 3300049579 Ga0501043_0212164 Ga0501043_0212164_1018_1350 100
146 3300049580 Ga0501046_0069291 Ga0501046_0069291_1107_1439 100
147 3300049581 Ga0501047_0002695 Ga0501047_0002695_14069_14401 100
148 3300049582 Ga0501048_0046679 Ga0501048_0046679_1006_1338 100
149 3300049586 Ga0501070_0338889 Ga0501070_0338889_814_1146 100
150 3300049588 Ga0501072_0658188 Ga0501072_0658188_412_732 100
151 3300049589 Ga0501073_0130876 Ga0501073_0130876_419_739 100
152 3300049822 Ga0501035_0003408 Ga0501035_0003408_12387_12719 100
153 3300049823 Ga0501044_0004718 Ga0501044_0004718_12387_12719 100
154 3300054114 Ga0501084_0002617 Ga0501084_0002617_6642_6962 100
155 3300060353 Ga0501082_1274040 Ga0501082_1274040_83_403 100
156 3300005345 Ga0070692_10118973 Ga0070692_101189733 101
157 3300009553 Ga0105249_10085957 Ga0105249_100859574 101
158 3300035090 Ga0373949_0014826 Ga0373949_0014826_1339_1656 101
159 3300035115 Ga0373941_0050800 Ga0373941_0050800_147_464 101
160 3300042876 Ga0451577_0150165 Ga0451577_0150165_104_421 101
161 3300003320 rootH2_10085066 rootH2_100850664 102
162 3300044673 Ga0453683_0063736 Ga0453683_0063736_74_400 102

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05016

ParE_toxin

ParE toxin of type II toxin-antitoxin system, parDE

5

99

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ycu-assembly1.cif.gz_C-2 heterotetramer of antitoxin prpa together with toxin prpt from pseudoalteromonas rubra 0.895 1 84
8c24-assembly1.cif.gz_B parde1 toxin-antitoxin complex from mycobacterium tuberculosis (rv1960c-rv1959c) 0.8895 1 89
5ceg-assembly1.cif.gz_B x-ray structure of toxin/anti-toxin complex from mesorhizobium opportunistum 0.8832 2 87
5czf-assembly2.cif.gz_C crystal structure of the paaa2-pare2 antitoxin-toxin complex 0.8781 2 87
6x0a-assembly17.cif.gz_Q x-ray structure of a chimeric parde toxin-antitoxin complex from mesorhizobium opportunistum 0.8734 1 87
ID Description Score Start End Superfamily
af_P9WHG7_1_98_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9164 2 87 3.30.2310.20
5cw7F00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8787 2 87 3.30.2310.20
5cegD00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8746 2 87 3.30.2310.20
af_P9WHG5_4_92_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8696 1 89 3.30.2310.20
af_P9WHG5_4_92_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8609 1 89 3.30.2310.20
ID Description Score Start End GO Terms
AF-A0A524KGB4-F1-model_v4 Type II toxin-antitoxin system RelE/ParE family toxin 0.9877 2 96
AF-A0A3A4W561-F1-model_v4 Type II toxin-antitoxin system RelE/ParE family toxin 0.987 2 96 GO:0016020
AF-A0A533B4H7-F1-model_v4 Plasmid stabilization system 0.9846 1 95
AF-A0A841RBB8-F1-model_v4 Plasmid stabilization system protein ParE 0.9832 2 95
AF-A0A7C4SCI0-F1-model_v4 Type II toxin-antitoxin system RelE/ParE family toxin 0.9829 1 92

Feature Viewer

pLDDT pTM Quality
90.84 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map