F239764

General Info

Members Datasets Scaffolds Average Seq Length
162 70 162 260

Family's Representative Sequence

Representative Sequence 3300036647|Ga0316582_0047821|Ga0316582_0047821_1537_2424
Length 295
Sequence MFKRLRVKPEPSKIGPDSGGISVSQLIGDANLPVTIKALNSLPENPKLRLYRTLIPIQVLADFDINPRTWQSPDKLTQVRLEAEKDSNKVKITAWYGEDPSNEFFYLELADNAYNGIDLNFLIVNNPTSPRFRTDFDDEGKETLFGTVRRNLAAEEKAMRAGLAPGQIREGLRCSRIVFTHIETFLTMMAHHAFFLEPLTYVSAWIFEKRGFAYSKGHQLMDTIHKEFQPGGELHKALDGSTPFRQPDQWKTVRGRAWAIHDGILEAIDRKWDDLKMIKQVGRHAGANTFPDAEY

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
14 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
17 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
18 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
19 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
20 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
29 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
32 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
41 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
42 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
43 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
44 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
45 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
46 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
47 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
48 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
49 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
50 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
51 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
52 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
53 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
54 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
55 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
56 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
57 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
58 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
59 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
60 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
61 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
62 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
63 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
64 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
65 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
66 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
67 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
68 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
69 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
70 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 98.77
Stem 0
Stem Tuber 0
Unclassified 1.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2224202 2162886007 Bacteria 2482
2 JGI25406J46586_10010555 3300003203 Bacteria 4094
3 rootH2_10228827 3300003320 Unclassified 1370
4 Ga0065704_10070816 3300005289 Bacteria 15740
5 Ga0065704_10081808 3300005289 Bacteria 3699
6 Ga0065712_10103182 3300005290 Bacteria 1990
7 Ga0065707_10000592 3300005295 Bacteria 25986
8 Ga0065707_10084900 3300005295 Bacteria 6656
9 Ga0065707_10089101 3300005295 Bacteria 4463
10 Ga0070705_100057733 3300005440 Bacteria 2291
11 Ga0070705_100060363 3300005440 Bacteria 2249
12 Ga0070705_100416195 3300005440 Unclassified 999
13 Ga0070694_100047221 3300005444 Bacteria 2893
14 Ga0068867_100527241 3300005459 Unclassified 1019
15 Ga0070707_100269420 3300005468 Bacteria 1656
16 Ga0070698_100005534 3300005471 Bacteria 13802
17 Ga0070698_100160180 3300005471 Bacteria 2195
18 Ga0070698_100317525 3300005471 Bacteria 1488
19 Ga0070699_100011928 3300005518 Bacteria 7501
20 Ga0070699_100017687 3300005518 Bacteria 6121
21 Ga0070699_100283796 3300005518 Unclassified 1483
22 Ga0070699_100570506 3300005518 Bacteria 1031
23 Ga0070695_100163862 3300005545 Bacteria 1563
24 Ga0070704_100028384 3300005549 Bacteria 3722
25 Ga0068857_100120278 3300005577 Bacteria 2364
26 Ga0068857_100338654 3300005577 Bacteria 1391
27 Ga0068864_100276481 3300005618 Unclassified 1566
28 Ga0068861_100110197 3300005719 Unclassified 2205
29 Ga0068870_10164710 3300005840 Bacteria 1318
30 Ga0068862_100013482 3300005844 Bacteria 6767
31 Ga0068862_100094578 3300005844 Bacteria 2607
32 Ga0081539_10009860 3300005985 Bacteria 7880
33 Ga0081539_10117196 3300005985 Bacteria 1329
34 Ga0075427_10001444 3300006194 Bacteria 3047
35 Ga0075428_100085229 3300006844 Bacteria 3446
36 Ga0075428_100182274 3300006844 Bacteria 2272
37 Ga0075428_100247547 3300006844 Bacteria 1921
38 Ga0075430_100266324 3300006846 Bacteria 1419
39 Ga0075431_100043081 3300006847 Unclassified 4657
40 Ga0075433_10121130 3300006852 Bacteria 2323
41 Ga0075429_100004431 3300006880 Bacteria 12065
42 Ga0075429_100037217 3300006880 Bacteria 4237
43 Ga0075429_100061872 3300006880 Bacteria 3261
44 Ga0075429_100168126 3300006880 Bacteria 1921
45 Ga0075429_100300884 3300006880 Bacteria 1404
46 Ga0075429_100506796 3300006880 Unclassified 1057
47 Ga0114129_10001670 3300009147 Bacteria 30222
48 Ga0114129_10024044 3300009147 Bacteria 8633
49 Ga0114129_10029671 3300009147 Bacteria 7745
50 Ga0114129_10040113 3300009147 Bacteria 6601
51 Ga0114129_10074885 3300009147 Bacteria 4714
52 Ga0114129_10109960 3300009147 Unclassified 3804
53 Ga0105243_10037329 3300009148 Bacteria 3775
54 Ga0105249_10018473 3300009553 Bacteria 6205
55 Ga0105249_10080959 3300009553 Bacteria 3017
56 Ga0105249_10222256 3300009553 Bacteria 1859
57 Ga0105249_10256738 3300009553 Bacteria 1735
58 Ga0105249_10682869 3300009553 Unclassified 1086
59 Ga0105239_10961350 3300010375 Bacteria 981
60 Ga0157380_10038288 3300014326 Bacteria 3722
61 Ga0207646_10107966 3300025922 Bacteria 2497
62 Ga0207709_10021961 3300025935 Unclassified 3616
63 Ga0207709_10059597 3300025935 Unclassified 2377
64 Ga0207712_10217080 3300025961 Bacteria 1527
65 Ga0207641_10197016 3300026088 Bacteria 1855
66 Ga0207676_10262517 3300026095 Unclassified 1560
67 Ga0207674_10089058 3300026116 Unclassified 3079
68 Ga0207674_10132357 3300026116 Bacteria 2456
69 Ga0207675_100063029 3300026118 Bacteria 3464
70 Ga0268265_10490073 3300028380 Bacteria 1156
71 Ga0316579_10042634 3300031691 Unclassified 2108
72 Ga0316579_10092493 3300031691 Bacteria 1445
73 Ga0316579_10112365 3300031691 Bacteria 1307
74 Ga0316579_10157709 3300031691 Unclassified 1096
75 Ga0316579_10196663 3300031691 Unclassified 975
76 Ga0316576_10015040 3300031727 Bacteria 5181
77 Ga0316576_10030255 3300031727 Unclassified 3833
78 Ga0316578_10213945 3300031728 Unclassified 1159
79 Ga0316578_10215644 3300031728 Bacteria 1154
80 Ga0307405_10247782 3300031731 Unclassified 1324
81 Ga0316577_10002594 3300031733 Bacteria 8980
82 Ga0316577_10207389 3300031733 Bacteria 1108
83 Ga0316577_10256950 3300031733 Unclassified 988
84 Ga0307410_10410328 3300031852 Unclassified 1096
85 Ga0307407_10116506 3300031903 Bacteria 1686
86 Ga0307412_10171197 3300031911 Bacteria 1624
87 Ga0307409_100371641 3300031995 Bacteria 1356
88 Ga0307415_100528318 3300032126 Unclassified 1037
89 Ga0316574_0051161 3300035398 Bacteria 2574
90 Ga0316582_0047821 3300036647 Bacteria 2702
91 Ga0316582_0073694 3300036647 Bacteria 2216
92 Ga0316582_0083324 3300036647 Bacteria 2092
93 Ga0316582_0359122 3300036647 Bacteria 1002
94 Ga0316584_0029533 3300036712 Bacteria 4047
95 Ga0316584_0070401 3300036712 Bacteria 2622
96 Ga0316584_0080881 3300036712 Bacteria 2434
97 Ga0316584_0093310 3300036712 Unclassified 2254
98 Ga0316584_0148274 3300036712 Bacteria 1747
99 Ga0316584_0364032 3300036712 Bacteria 1036
100 Ga0316584_0439580 3300036712 Unclassified 924
101 Ga0316581_0008249 3300037588 Bacteria 2827
102 Ga0316581_0028856 3300037588 Bacteria 1664
103 Ga0316581_0081801 3300037588 Unclassified 994
104 Ga0400490_32803 3300038726 Bacteria 1602
105 Ga0451577_0045622 3300042876 Bacteria 3923
106 Ga0451577_0317090 3300042876 Bacteria 1413
107 Ga0451577_0426064 3300042876 Unclassified 1205
108 Ga0453683_0042875 3300044673 Unclassified 2841
109 Ga0453683_0069010 3300044673 Bacteria 2210
110 Ga0453683_0114425 3300044673 Bacteria 1697
111 Ga0453683_0312232 3300044673 Bacteria 1006
112 Ga0453684_0000318 3300044712 Bacteria 203553
113 Ga0453684_0002504 3300044712 Bacteria 44331
114 Ga0453684_0016965 3300044712 Bacteria 11319
115 Ga0453684_0057216 3300044712 Bacteria 5049
116 Ga0453684_0091186 3300044712 Bacteria 3762
117 Ga0453684_0106721 3300044712 Bacteria 3412
118 Ga0453684_0117886 3300044712 Bacteria 3212
119 Ga0453684_0154271 3300044712 Bacteria 2725
120 Ga0453684_0159127 3300044712 Unclassified 2673
121 Ga0453684_0184147 3300044712 Bacteria 2449
122 Ga0453684_0219391 3300044712 Unclassified 2204
123 Ga0453684_0236017 3300044712 Bacteria 2108
124 Ga0453684_0273198 3300044712 Bacteria 1930
125 Ga0453684_0302650 3300044712 Bacteria 1817
126 Ga0453684_0330236 3300044712 Bacteria 1725
127 Ga0453684_0423983 3300044712 Unclassified 1486
128 Ga0453684_0469461 3300044712 Bacteria 1398
129 Ga0453684_0759763 3300044712 Bacteria 1049
130 Ga0453684_0778553 3300044712 Bacteria 1033
131 Ga0453684_0778933 3300044712 Bacteria 1033
132 Ga0451576_0000189 3300045051 Bacteria 155001
133 Ga0451576_0005017 3300045051 Bacteria 16814
134 Ga0451576_0008409 3300045051 Bacteria 12113
135 Ga0451576_0024977 3300045051 Bacteria 6444
136 Ga0451576_0093120 3300045051 Bacteria 3133
137 Ga0451576_0171056 3300045051 Bacteria 2268
138 Ga0451576_0181159 3300045051 Bacteria 2200
139 Ga0451576_0250916 3300045051 Bacteria 1849
140 Ga0451576_0707534 3300045051 Unclassified 1058
141 Ga0501042_0275130 3300049578 Bacteria 1216
142 Ga0501071_0262453 3300049587 Bacteria 1305
143 Ga0501073_0032287 3300049589 Bacteria 3732
144 Ga0501073_0077864 3300049589 Bacteria 2307
145 Ga0501073_0301718 3300049589 Bacteria 1105
146 Ga0501074_0073351 3300049590 Bacteria 2459
147 Ga0501075_0041497 3300049591 Bacteria 3448
148 Ga0501076_0116086 3300049592 Bacteria 2166
149 Ga0501080_0107955 3300049742 Bacteria 2580
150 nmdc:mga05p37_163412_c1 3300050507 Bacteria 2718
151 nmdc:mga05p37_488522_c1 3300050507 Bacteria 1416
152 nmdc:mga05p37_856_c1 3300050507 Bacteria 34254
153 nmdc:mga05p37_91871_c1 3300050507 Bacteria 3740
154 nmdc:mga05p37_94488_c1 3300050507 Bacteria 3684
155 nmdc:mga09592_101114_c1 3300050508 Bacteria 2470
156 nmdc:mga09592_143492_c1 3300050508 Bacteria 2059
157 nmdc:mga09592_5747_c1 3300050508 Bacteria 10114
158 nmdc:mga09592_575403_c1 3300050508 Bacteria 966
159 nmdc:mga0qj67_371933_c1 3300050509 Unclassified 1154
160 nmdc:mga06r32_178920_c1 3300050510 Bacteria 2106
161 nmdc:mga06r32_444195_c1 3300050510 Bacteria 1277
162 Ga0501084_0001771 3300054114 Bacteria 17183

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_0317090 Ga0451577_0317090_676_1371 229
2 3300050507 nmdc:mga05p37_91871_c1 nmdc:mga05p37_91871_c1_34_726 230
3 3300036647 Ga0316582_0359122 Ga0316582_0359122_11_727 235
4 3300036712 Ga0316584_0364032 Ga0316584_0364032_279_1019 239
5 3300037588 Ga0316581_0081801 Ga0316581_0081801_17_757 239
6 3300005289 Ga0065704_10081808 Ga0065704_100818082 240
7 3300005440 Ga0070705_100416195 Ga0070705_1004161951 240
8 3300005618 Ga0068864_100276481 Ga0068864_1002764811 240
9 3300005844 Ga0068862_100094578 Ga0068862_1000945783 240
10 3300026095 Ga0207676_10262517 Ga0207676_102625173 240
11 3300044712 Ga0453684_0236017 Ga0453684_0236017_591_1343 248
12 3300031733 Ga0316577_10256950 Ga0316577_102569502 254
13 3300036712 Ga0316584_0439580 Ga0316584_0439580_45_854 254
14 2162886007 SwRhRL2b_contig_2224202 SwRhRL2b_0891.00005170 258
15 3300003203 JGI25406J46586_10010555 JGI25406J46586_100105552 258
16 3300003320 rootH2_10228827 rootH2_102288272 258
17 3300005289 Ga0065704_10070816 Ga0065704_100708169 258
18 3300005290 Ga0065712_10103182 Ga0065712_101031823 258
19 3300005295 Ga0065707_10000592 Ga0065707_100005924 258
20 3300005295 Ga0065707_10084900 Ga0065707_100849002 258
21 3300005295 Ga0065707_10089101 Ga0065707_100891014 258
22 3300005440 Ga0070705_100057733 Ga0070705_1000577333 258
23 3300005440 Ga0070705_100060363 Ga0070705_1000603632 258
24 3300005444 Ga0070694_100047221 Ga0070694_1000472213 258
25 3300005459 Ga0068867_100527241 Ga0068867_1005272412 258
26 3300005468 Ga0070707_100269420 Ga0070707_1002694202 258
27 3300005471 Ga0070698_100005534 Ga0070698_1000055341 258
28 3300005471 Ga0070698_100160180 Ga0070698_1001601803 258
29 3300005471 Ga0070698_100317525 Ga0070698_1003175252 258
30 3300005518 Ga0070699_100011928 Ga0070699_1000119281 258
31 3300005518 Ga0070699_100017687 Ga0070699_1000176874 258
32 3300005518 Ga0070699_100283796 Ga0070699_1002837961 258
33 3300005518 Ga0070699_100570506 Ga0070699_1005705061 258
34 3300005545 Ga0070695_100163862 Ga0070695_1001638622 258
35 3300005549 Ga0070704_100028384 Ga0070704_1000283842 258
36 3300005577 Ga0068857_100120278 Ga0068857_1001202782 258
37 3300005577 Ga0068857_100338654 Ga0068857_1003386542 258
38 3300005719 Ga0068861_100110197 Ga0068861_1001101971 258
39 3300005840 Ga0068870_10164710 Ga0068870_101647101 258
40 3300005844 Ga0068862_100013482 Ga0068862_1000134823 258
41 3300005985 Ga0081539_10009860 Ga0081539_100098603 258
42 3300005985 Ga0081539_10117196 Ga0081539_101171962 258
43 3300006194 Ga0075427_10001444 Ga0075427_100014443 258
44 3300006844 Ga0075428_100085229 Ga0075428_1000852292 258
45 3300006844 Ga0075428_100182274 Ga0075428_1001822741 258
46 3300006844 Ga0075428_100247547 Ga0075428_1002475472 258
47 3300006846 Ga0075430_100266324 Ga0075430_1002663242 258
48 3300006847 Ga0075431_100043081 Ga0075431_1000430815 258
49 3300006852 Ga0075433_10121130 Ga0075433_101211301 258
50 3300006880 Ga0075429_100004431 Ga0075429_1000044316 258
51 3300006880 Ga0075429_100037217 Ga0075429_1000372174 258
52 3300006880 Ga0075429_100061872 Ga0075429_1000618723 258
53 3300006880 Ga0075429_100168126 Ga0075429_1001681262 258
54 3300006880 Ga0075429_100300884 Ga0075429_1003008842 258
55 3300006880 Ga0075429_100506796 Ga0075429_1005067961 258
56 3300009147 Ga0114129_10001670 Ga0114129_1000167018 258
57 3300009147 Ga0114129_10024044 Ga0114129_100240443 258
58 3300009147 Ga0114129_10029671 Ga0114129_100296714 258
59 3300009147 Ga0114129_10040113 Ga0114129_100401135 258
60 3300009147 Ga0114129_10074885 Ga0114129_100748851 258
61 3300009147 Ga0114129_10109960 Ga0114129_101099602 258
62 3300009148 Ga0105243_10037329 Ga0105243_100373291 258
63 3300009553 Ga0105249_10018473 Ga0105249_100184736 258
64 3300009553 Ga0105249_10080959 Ga0105249_100809593 258
65 3300009553 Ga0105249_10222256 Ga0105249_102222561 258
66 3300009553 Ga0105249_10256738 Ga0105249_102567381 258
67 3300009553 Ga0105249_10682869 Ga0105249_106828691 258
68 3300010375 Ga0105239_10961350 Ga0105239_109613502 258
69 3300014326 Ga0157380_10038288 Ga0157380_100382884 258
70 3300025922 Ga0207646_10107966 Ga0207646_101079661 258
71 3300025935 Ga0207709_10021961 Ga0207709_100219613 258
72 3300025935 Ga0207709_10059597 Ga0207709_100595972 258
73 3300025961 Ga0207712_10217080 Ga0207712_102170802 258
74 3300026088 Ga0207641_10197016 Ga0207641_101970163 258
75 3300026116 Ga0207674_10089058 Ga0207674_100890583 258
76 3300026116 Ga0207674_10132357 Ga0207674_101323572 258
77 3300026118 Ga0207675_100063029 Ga0207675_1000630296 258
78 3300028380 Ga0268265_10490073 Ga0268265_104900732 258
79 3300031691 Ga0316579_10042634 Ga0316579_100426342 258
80 3300031691 Ga0316579_10092493 Ga0316579_100924932 258
81 3300031691 Ga0316579_10112365 Ga0316579_101123652 258
82 3300031691 Ga0316579_10157709 Ga0316579_101577091 258
83 3300031691 Ga0316579_10196663 Ga0316579_101966631 258
84 3300031727 Ga0316576_10015040 Ga0316576_100150404 258
85 3300031727 Ga0316576_10030255 Ga0316576_100302555 258
86 3300031728 Ga0316578_10213945 Ga0316578_102139452 258
87 3300031728 Ga0316578_10215644 Ga0316578_102156442 258
88 3300031731 Ga0307405_10247782 Ga0307405_102477822 258
89 3300031733 Ga0316577_10002594 Ga0316577_100025943 258
90 3300031733 Ga0316577_10207389 Ga0316577_102073892 258
91 3300031852 Ga0307410_10410328 Ga0307410_104103282 258
92 3300031903 Ga0307407_10116506 Ga0307407_101165062 258
93 3300031911 Ga0307412_10171197 Ga0307412_101711972 258
94 3300031995 Ga0307409_100371641 Ga0307409_1003716412 258
95 3300032126 Ga0307415_100528318 Ga0307415_1005283182 258
96 3300035398 Ga0316574_0051161 Ga0316574_0051161_228_1016 258
97 3300036647 Ga0316582_0047821 Ga0316582_0047821_1537_2424 258
98 3300036647 Ga0316582_0073694 Ga0316582_0073694_771_1622 258
99 3300036647 Ga0316582_0083324 Ga0316582_0083324_273_1064 258
100 3300036712 Ga0316584_0029533 Ga0316584_0029533_2345_3196 258
101 3300036712 Ga0316584_0070401 Ga0316584_0070401_1555_2346 258
102 3300036712 Ga0316584_0080881 Ga0316584_0080881_1565_2350 258
103 3300036712 Ga0316584_0093310 Ga0316584_0093310_608_1393 258
104 3300036712 Ga0316584_0148274 Ga0316584_0148274_46_876 258
105 3300037588 Ga0316581_0008249 Ga0316581_0008249_68_907 258
106 3300037588 Ga0316581_0028856 Ga0316581_0028856_553_1404 258
107 3300038726 Ga0400490_32803 Ga0400490_32803_136_966 258
108 3300042876 Ga0451577_0045622 Ga0451577_0045622_2702_3478 258
109 3300042876 Ga0451577_0426064 Ga0451577_0426064_383_1159 258
110 3300044673 Ga0453683_0042875 Ga0453683_0042875_1144_1968 258
111 3300044673 Ga0453683_0069010 Ga0453683_0069010_1334_2116 258
112 3300044673 Ga0453683_0114425 Ga0453683_0114425_189_971 258
113 3300044673 Ga0453683_0312232 Ga0453683_0312232_63_845 258
114 3300044712 Ga0453684_0000318 Ga0453684_0000318_74575_75357 258
115 3300044712 Ga0453684_0002504 Ga0453684_0002504_4789_5571 258
116 3300044712 Ga0453684_0016965 Ga0453684_0016965_8102_8884 258
117 3300044712 Ga0453684_0057216 Ga0453684_0057216_3687_4463 258
118 3300044712 Ga0453684_0091186 Ga0453684_0091186_2540_3322 258
119 3300044712 Ga0453684_0106721 Ga0453684_0106721_834_1616 258
120 3300044712 Ga0453684_0117886 Ga0453684_0117886_621_1403 258
121 3300044712 Ga0453684_0154271 Ga0453684_0154271_1805_2587 258
122 3300044712 Ga0453684_0159127 Ga0453684_0159127_1485_2267 258
123 3300044712 Ga0453684_0184147 Ga0453684_0184147_1440_2222 258
124 3300044712 Ga0453684_0219391 Ga0453684_0219391_631_1473 258
125 3300044712 Ga0453684_0273198 Ga0453684_0273198_1090_1872 258
126 3300044712 Ga0453684_0302650 Ga0453684_0302650_203_985 258
127 3300044712 Ga0453684_0330236 Ga0453684_0330236_693_1475 258
128 3300044712 Ga0453684_0423983 Ga0453684_0423983_118_900 258
129 3300044712 Ga0453684_0469461 Ga0453684_0469461_244_1026 258
130 3300044712 Ga0453684_0759763 Ga0453684_0759763_214_996 258
131 3300044712 Ga0453684_0778553 Ga0453684_0778553_20_796 258
132 3300044712 Ga0453684_0778933 Ga0453684_0778933_82_864 258
133 3300045051 Ga0451576_0000189 Ga0451576_0000189_89651_90433 258
134 3300045051 Ga0451576_0005017 Ga0451576_0005017_432_1244 258
135 3300045051 Ga0451576_0008409 Ga0451576_0008409_3289_4065 258
136 3300045051 Ga0451576_0024977 Ga0451576_0024977_3269_4114 258
137 3300045051 Ga0451576_0093120 Ga0451576_0093120_2125_2901 258
138 3300045051 Ga0451576_0171056 Ga0451576_0171056_145_927 258
139 3300045051 Ga0451576_0181159 Ga0451576_0181159_447_1223 258
140 3300045051 Ga0451576_0250916 Ga0451576_0250916_851_1627 258
141 3300045051 Ga0451576_0707534 Ga0451576_0707534_159_941 258
142 3300049578 Ga0501042_0275130 Ga0501042_0275130_18_800 258
143 3300049587 Ga0501071_0262453 Ga0501071_0262453_463_1245 258
144 3300049589 Ga0501073_0032287 Ga0501073_0032287_1143_1928 258
145 3300049589 Ga0501073_0077864 Ga0501073_0077864_985_1770 258
146 3300049589 Ga0501073_0301718 Ga0501073_0301718_43_828 258
147 3300049590 Ga0501074_0073351 Ga0501074_0073351_1472_2254 258
148 3300049591 Ga0501075_0041497 Ga0501075_0041497_1218_2000 258
149 3300049592 Ga0501076_0116086 Ga0501076_0116086_288_1070 258
150 3300049742 Ga0501080_0107955 Ga0501080_0107955_1757_2539 258
151 3300050507 nmdc:mga05p37_163412_c1 nmdc:mga05p37_163412_c1_1688_2464 258
152 3300050507 nmdc:mga05p37_488522_c1 nmdc:mga05p37_488522_c1_15_791 258
153 3300050507 nmdc:mga05p37_856_c1 nmdc:mga05p37_856_c1_15735_16511 258
154 3300050507 nmdc:mga05p37_94488_c1 nmdc:mga05p37_94488_c1_380_1156 258
155 3300050508 nmdc:mga09592_101114_c1 nmdc:mga09592_101114_c1_1057_1833 258
156 3300050508 nmdc:mga09592_143492_c1 nmdc:mga09592_143492_c1_473_1249 258
157 3300050508 nmdc:mga09592_5747_c1 nmdc:mga09592_5747_c1_6629_7405 258
158 3300050508 nmdc:mga09592_575403_c1 nmdc:mga09592_575403_c1_156_950 258
159 3300050509 nmdc:mga0qj67_371933_c1 nmdc:mga0qj67_371933_c1_150_926 258
160 3300050510 nmdc:mga06r32_178920_c1 nmdc:mga06r32_178920_c1_498_1274 258
161 3300050510 nmdc:mga06r32_444195_c1 nmdc:mga06r32_444195_c1_135_911 258
162 3300054114 Ga0501084_0001771 Ga0501084_0001771_2107_2892 258

Structural Annotation

Top 5 Hits

ID Description Score Start End
4r4k-assembly1.cif.gz_A crystal structure of a cystatin-like protein (baccac_01506) from bacteroides caccae atcc 43185 at 1.69 a resolution 0.7285 45 85
2ft0-assembly1.cif.gz_B crystal structure of tdp-fucosamine acetyltransferase (wecd)- complex with acetyl-coa 0.7262 56 90
2ml6-assembly1.cif.gz_A nmr structure of protein zp_02069618.1 from bacteroides uniformis atcc 8492 0.6763 45 85
6x08-assembly1.cif.gz_A nup85-seh1 from s. cerevisiae bound by vhh-san2 0.6709 46 89
4o3z-assembly1.cif.gz_A crystal structure of the vaccine antigen transferrin binding protein b (tbpb) mutant tyr-95-ala from actinobacillus pleuropneumoniae h87 0.6637 47 76
ID Description Score Start End Superfamily
4r4kA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7285 45 85 3.10.450.410
2fs5B00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7265 55 90 3.40.630.30
af_Q8BIA4_196_353_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7141 45 90 2.130.10.10
2ml6A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.6763 45 85 3.10.450.410
af_K7N3V2_273_440_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6392 42 90 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A3N5GC41-F1-model_v4 Uncharacterized protein 0.9885 1 258
AF-A0A7C5JVF1-F1-model_v4 N-acetyltransferase domain-containing protein 0.9881 44 258
AF-A0A3N5GC41-F1-model_v4 Uncharacterized protein 0.9847 1 258
AF-A0A7C5JVF1-F1-model_v4 N-acetyltransferase domain-containing protein 0.9835 44 258
AF-A0A2V7I0H3-F1-model_v4 Uncharacterized protein 0.9792 75 258

Feature Viewer

pLDDT pTM Quality
95.32 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map