F239627

General Info

Members Datasets Scaffolds Average Seq Length
162 69 324 235

Family's Representative Sequence

Representative Sequence 3300031665|Ga0316575_10013263|Ga0316575_100132633
Length 245
Sequence VTSPAYIDNIEQALREGELELKGQFMLGSNYTFLVTVRYQQRELKAVYKPSRGEQPLWDFPDNTLAQREVAAYVVSEALGFHFVPCTVLREDTPVYGAGSLQQYIEYDPEYHYFNFSQEDKERLRPVVLFDLLINNADRKGSHVLIEKPTRKLWAIDHGLCFHEEDKLRTVLWDFAGQPIAADLLGCMASVPSLLQGNSELHAALAPLLEPREMQAIALRARRLLQAGVFPPPPRNRRAFPYPPV

Samples

Sample ID Description Type Environment
1 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
33 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
41 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
42 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
43 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
44 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
45 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
46 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
47 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
48 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
49 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
50 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
51 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
52 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
53 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
54 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
55 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
56 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
57 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
58 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
59 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
60 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
61 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
62 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
63 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
64 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
65 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
66 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
67 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
68 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
69 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 31.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316575_10013263 3300031665 Bacteria 3075
2 SwRhRL2b_contig_1750386 2162886007 Bacteria 5048
3 SwRhRL2b_contig_894737 2162886007 Bacteria 3265
4 JGI25406J46586_10034147 3300003203 Unclassified 1871
5 Ga0065704_10075062 3300005289 Bacteria 5811
6 Ga0065715_10291215 3300005293 Unclassified 1062
7 Ga0065707_10000518 3300005295 Bacteria 31549
8 Ga0065707_10004881 3300005295 Unclassified 3187
9 Ga0068869_100441022 3300005334 Unclassified 1078
10 Ga0070680_100476520 3300005336 Unclassified 1067
11 Ga0070689_100047180 3300005340 Unclassified 3321
12 Ga0070689_100333661 3300005340 Bacteria 1269
13 Ga0070705_100198213 3300005440 Unclassified 1374
14 Ga0070694_100042953 3300005444 Bacteria 3021
15 Ga0070694_100079117 3300005444 Bacteria 2282
16 Ga0070694_100099733 3300005444 Bacteria 2053
17 Ga0070694_100223326 3300005444 Unclassified 1414
18 Ga0070662_100757190 3300005457 Unclassified 824
19 Ga0070706_100047476 3300005467 Bacteria 3962
20 Ga0070707_100443401 3300005468 Bacteria 1259
21 Ga0070698_100070237 3300005471 Bacteria 3514
22 Ga0070698_100091396 3300005471 Bacteria 3026
23 Ga0070698_100323367 3300005471 Bacteria 1473
24 Ga0070698_100590557 3300005471 Bacteria 1051
25 Ga0070698_100846356 3300005471 Unclassified 859
26 Ga0070699_100010302 3300005518 Bacteria 8085
27 Ga0070699_100089056 3300005518 Bacteria 2696
28 Ga0070695_100049392 3300005545 Bacteria 2694
29 Ga0070695_100323689 3300005545 Bacteria 1147
30 Ga0070704_100093943 3300005549 Bacteria 2243
31 Ga0070704_100162111 3300005549 Bacteria 1769
32 Ga0068859_100053280 3300005617 Bacteria 4069
33 Ga0068859_100212733 3300005617 Bacteria 2020
34 Ga0068859_100304511 3300005617 Bacteria 1687
35 Ga0068870_10102844 3300005840 Unclassified 1618
36 Ga0068862_100055500 3300005844 Bacteria 3393
37 Ga0081539_10007890 3300005985 Bacteria 9492
38 Ga0081539_10015177 3300005985 Bacteria 5623
39 Ga0075428_100019571 3300006844 Bacteria 7490
40 Ga0075428_100108371 3300006844 Unclassified 3027
41 Ga0075430_100068305 3300006846 Unclassified 2982
42 Ga0075430_100137424 3300006846 Bacteria 2036
43 Ga0075431_100115634 3300006847 Unclassified 2769
44 Ga0075431_100536127 3300006847 Bacteria 1159
45 Ga0075433_10285975 3300006852 Bacteria 1460
46 Ga0075434_100245621 3300006871 Bacteria 1810
47 Ga0075429_100003997 3300006880 Bacteria 12626
48 Ga0075429_100008819 3300006880 Bacteria 8768
49 Ga0075429_100031759 3300006880 Bacteria 4589
50 Ga0075429_100054557 3300006880 Bacteria 3476
51 Ga0075429_100054767 3300006880 Bacteria 3470
52 Ga0075429_100433139 3300006880 Unclassified 1152
53 Ga0097620_100053282 3300006931 Bacteria 4069
54 Ga0097620_100212752 3300006931 Bacteria 2020
55 Ga0097620_100304487 3300006931 Bacteria 1687
56 Ga0114129_10005535 3300009147 Bacteria 17866
57 Ga0114129_10012933 3300009147 Bacteria 11877
58 Ga0114129_10014136 3300009147 Bacteria 11372
59 Ga0114129_10061437 3300009147 Bacteria 5250
60 Ga0114129_10069822 3300009147 Bacteria 4898
61 Ga0114129_10092496 3300009147 Bacteria 4190
62 Ga0114129_11081621 3300009147 Bacteria 1005
63 Ga0105243_10064505 3300009148 Bacteria 2939
64 Ga0105243_10086159 3300009148 Unclassified 2576
65 Ga0105243_10618335 3300009148 Bacteria 1045
66 Ga0105246_10144389 3300011119 Bacteria 1794
67 Ga0105246_10151868 3300011119 Unclassified 1754
68 Ga0207643_10092647 3300025908 Unclassified 1763
69 Ga0207684_10023130 3300025910 Bacteria 5307
70 Ga0207684_10509363 3300025910 Unclassified 1031
71 Ga0207646_10203585 3300025922 Bacteria 1788
72 Ga0207709_10150814 3300025935 Unclassified 1610
73 Ga0207709_10659477 3300025935 Unclassified 834
74 Ga0207674_10209935 3300026116 Bacteria 1896
75 Ga0207674_10547656 3300026116 Unclassified 1118
76 Ga0209981_1007456 3300027378 Bacteria 1476
77 Ga0268265_10431234 3300028380 Unclassified 1226
78 Ga0265340_10003341 3300031247 Bacteria 9090
79 Ga0265340_10145078 3300031247 Bacteria 1084
80 Ga0265316_10507493 3300031344 Bacteria 861
81 Ga0316579_10099883 3300031691 Unclassified 1389
82 Ga0307410_10317442 3300031852 Bacteria 1235
83 Ga0307407_10532341 3300031903 Bacteria 866
84 Ga0307409_100495345 3300031995 Unclassified 1189
85 Ga0307415_100231993 3300032126 Bacteria 1487
86 Ga0316582_0006540 3300036647 Bacteria 6131
87 Ga0316582_0034320 3300036647 Unclassified 3124
88 Ga0451577_0002448 3300042876 Bacteria 22113
89 Ga0451577_0004921 3300042876 Bacteria 13906
90 Ga0451577_0006421 3300042876 Bacteria 11731
91 Ga0451577_0361396 3300042876 Unclassified 1317
92 Ga0451577_0379532 3300042876 Unclassified 1283
93 Ga0451577_1173470 3300042876 Bacteria 685
94 Ga0453683_0000428 3300044673 Bacteria 48196
95 Ga0453683_0003581 3300044673 Bacteria 11415
96 Ga0453683_0003633 3300044673 Bacteria 11306
97 Ga0453683_0210452 3300044673 Bacteria 1235
98 Ga0453684_0000012 3300044712 Bacteria 1062512
99 Ga0453684_0000164 3300044712 Bacteria 296093
100 Ga0453684_0002264 3300044712 Bacteria 47516
101 Ga0453684_0002391 3300044712 Bacteria 45742
102 Ga0453684_0017801 3300044712 Bacteria 10966
103 Ga0453684_0021260 3300044712 Bacteria 9709
104 Ga0453684_0044209 3300044712 Bacteria 5967
105 Ga0453684_0049126 3300044712 Bacteria 5568
106 Ga0453684_0056840 3300044712 Bacteria 5071
107 Ga0453684_0059949 3300044712 Bacteria 4900
108 Ga0453684_0064927 3300044712 Unclassified 4658
109 Ga0453684_0066508 3300044712 Bacteria 4589
110 Ga0453684_0120463 3300044712 Bacteria 3169
111 Ga0453684_0132596 3300044712 Unclassified 2988
112 Ga0453684_0173744 3300044712 Bacteria 2536
113 Ga0453684_0201779 3300044712 Unclassified 2318
114 Ga0453684_0285254 3300044712 Bacteria 1882
115 Ga0453684_0304416 3300044712 Bacteria 1811
116 Ga0453684_0390640 3300044712 Bacteria 1560
117 Ga0453684_0542113 3300044712 Bacteria 1283
118 Ga0453684_0828263 3300044712 Bacteria 996
119 Ga0453684_1195025 3300044712 Bacteria 799
120 Ga0451576_0001980 3300045051 Bacteria 32542
121 Ga0451576_0021325 3300045051 Bacteria 7041
122 Ga0451576_0057675 3300045051 Bacteria 4059
123 Ga0451576_0142592 3300045051 Bacteria 2498
124 Ga0451576_0195441 3300045051 Unclassified 2113
125 Ga0451576_0900900 3300045051 Unclassified 928
126 Ga0501298_026726 3300049521 Unclassified 1112
127 Ga0501039_0335615 3300049575 Unclassified 1188
128 Ga0501041_0324766 3300049577 Unclassified 971
129 Ga0501068_0128455 3300049584 Bacteria 1584
130 Ga0501071_0125105 3300049587 Unclassified 1908
131 Ga0501072_0062739 3300049588 Bacteria 2931
132 Ga0501072_0095023 3300049588 Bacteria 2369
133 Ga0501074_0199507 3300049590 Unclassified 1426
134 Ga0501075_0022833 3300049591 Unclassified 4575
135 Ga0501075_0276059 3300049591 Bacteria 1281
136 Ga0501075_0313133 3300049591 Bacteria 1196
137 Ga0501076_0004002 3300049592 Bacteria 10413
138 Ga0501076_0634375 3300049592 Unclassified 882
139 Ga0501079_0464851 3300049741 Unclassified 994
140 Ga0501079_0533218 3300049741 Unclassified 923
141 Ga0501080_0050144 3300049742 Unclassified 3886
142 Ga0501080_0298291 3300049742 Bacteria 1462
143 Ga0501081_0325416 3300049743 Unclassified 1130
144 nmdc:mga05p37_1045809_c1 3300050507 Bacteria 862
145 nmdc:mga05p37_19995_c1 3300050507 Bacteria 8102
146 nmdc:mga05p37_229774_c1 3300050507 Bacteria 2236
147 nmdc:mga05p37_38944_c1 3300050507 Bacteria 5832
148 nmdc:mga05p37_8904_c1 3300050507 Bacteria 11860
149 nmdc:mga09592_12154_c1 3300050508 Bacteria 7006
150 nmdc:mga09592_26113_c1 3300050508 Bacteria 4837
151 nmdc:mga09592_348392_c1 3300050508 Bacteria 1282
152 nmdc:mga09592_402681_c1 3300050508 Unclassified 1183
153 nmdc:mga09592_53189_c1 3300050508 Unclassified 3418
154 nmdc:mga09592_64372_c1 3300050508 Unclassified 3104
155 nmdc:mga09592_90546_c1 3300050508 Unclassified 2614
156 nmdc:mga06r32_280291_c1 3300050510 Unclassified 1654
157 nmdc:mga06r32_335671_c1 3300050510 Bacteria 1496
158 nmdc:mga0n895_174011_c1 3300050512 Bacteria 2184
159 nmdc:mga0n895_530954_c1 3300050512 Unclassified 1183
160 nmdc:mga0a205_213427_c1 3300050515 Bacteria 1817
161 nmdc:mga0a205_243364_c1 3300050515 Bacteria 1680
162 Ga0530510_0356914 3300061734 Unclassified 1098
163 Ga0316575_10013263
164 SwRhRL2b_contig_1750386
165 SwRhRL2b_contig_894737
166 JGI25406J46586_10034147
167 Ga0065704_10075062
168 Ga0065715_10291215
169 Ga0065707_10000518
170 Ga0065707_10004881
171 Ga0068869_100441022
172 Ga0070680_100476520
173 Ga0070689_100047180
174 Ga0070689_100333661
175 Ga0070705_100198213
176 Ga0070694_100042953
177 Ga0070694_100079117
178 Ga0070694_100099733
179 Ga0070694_100223326
180 Ga0070662_100757190
181 Ga0070706_100047476
182 Ga0070707_100443401
183 Ga0070698_100070237
184 Ga0070698_100091396
185 Ga0070698_100323367
186 Ga0070698_100590557
187 Ga0070698_100846356
188 Ga0070699_100010302
189 Ga0070699_100089056
190 Ga0070695_100049392
191 Ga0070695_100323689
192 Ga0070704_100093943
193 Ga0070704_100162111
194 Ga0068859_100053280
195 Ga0068859_100212733
196 Ga0068859_100304511
197 Ga0068870_10102844
198 Ga0068862_100055500
199 Ga0081539_10007890
200 Ga0081539_10015177
201 Ga0075428_100019571
202 Ga0075428_100108371
203 Ga0075430_100068305
204 Ga0075430_100137424
205 Ga0075431_100115634
206 Ga0075431_100536127
207 Ga0075433_10285975
208 Ga0075434_100245621
209 Ga0075429_100003997
210 Ga0075429_100008819
211 Ga0075429_100031759
212 Ga0075429_100054557
213 Ga0075429_100054767
214 Ga0075429_100433139
215 Ga0097620_100053282
216 Ga0097620_100212752
217 Ga0097620_100304487
218 Ga0114129_10005535
219 Ga0114129_10012933
220 Ga0114129_10014136
221 Ga0114129_10061437
222 Ga0114129_10069822
223 Ga0114129_10092496
224 Ga0114129_11081621
225 Ga0105243_10064505
226 Ga0105243_10086159
227 Ga0105243_10618335
228 Ga0105246_10144389
229 Ga0105246_10151868
230 Ga0207643_10092647
231 Ga0207684_10023130
232 Ga0207684_10509363
233 Ga0207646_10203585
234 Ga0207709_10150814
235 Ga0207709_10659477
236 Ga0207674_10209935
237 Ga0207674_10547656
238 Ga0209981_1007456
239 Ga0268265_10431234
240 Ga0265340_10003341
241 Ga0265340_10145078
242 Ga0265316_10507493
243 Ga0316579_10099883
244 Ga0307410_10317442
245 Ga0307407_10532341
246 Ga0307409_100495345
247 Ga0307415_100231993
248 Ga0316582_0006540
249 Ga0316582_0034320
250 Ga0451577_0002448
251 Ga0451577_0004921
252 Ga0451577_0006421
253 Ga0451577_0361396
254 Ga0451577_0379532
255 Ga0451577_1173470
256 Ga0453683_0000428
257 Ga0453683_0003581
258 Ga0453683_0003633
259 Ga0453683_0210452
260 Ga0453684_0000012
261 Ga0453684_0000164
262 Ga0453684_0002264
263 Ga0453684_0002391
264 Ga0453684_0017801
265 Ga0453684_0021260
266 Ga0453684_0044209
267 Ga0453684_0049126
268 Ga0453684_0056840
269 Ga0453684_0059949
270 Ga0453684_0064927
271 Ga0453684_0066508
272 Ga0453684_0120463
273 Ga0453684_0132596
274 Ga0453684_0173744
275 Ga0453684_0201779
276 Ga0453684_0285254
277 Ga0453684_0304416
278 Ga0453684_0390640
279 Ga0453684_0542113
280 Ga0453684_0828263
281 Ga0453684_1195025
282 Ga0451576_0001980
283 Ga0451576_0021325
284 Ga0451576_0057675
285 Ga0451576_0142592
286 Ga0451576_0195441
287 Ga0451576_0900900
288 Ga0501298_026726
289 Ga0501039_0335615
290 Ga0501041_0324766
291 Ga0501068_0128455
292 Ga0501071_0125105
293 Ga0501072_0062739
294 Ga0501072_0095023
295 Ga0501074_0199507
296 Ga0501075_0022833
297 Ga0501075_0276059
298 Ga0501075_0313133
299 Ga0501076_0004002
300 Ga0501076_0634375
301 Ga0501079_0464851
302 Ga0501079_0533218
303 Ga0501080_0050144
304 Ga0501080_0298291
305 Ga0501081_0325416
306 nmdc:mga05p37_1045809_c1
307 nmdc:mga05p37_19995_c1
308 nmdc:mga05p37_229774_c1
309 nmdc:mga05p37_38944_c1
310 nmdc:mga05p37_8904_c1
311 nmdc:mga09592_12154_c1
312 nmdc:mga09592_26113_c1
313 nmdc:mga09592_348392_c1
314 nmdc:mga09592_402681_c1
315 nmdc:mga09592_53189_c1
316 nmdc:mga09592_64372_c1
317 nmdc:mga09592_90546_c1
318 nmdc:mga06r32_280291_c1
319 nmdc:mga06r32_335671_c1
320 nmdc:mga0n895_174011_c1
321 nmdc:mga0n895_530954_c1
322 nmdc:mga0a205_213427_c1
323 nmdc:mga0a205_243364_c1
324 Ga0530510_0356914

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wtv-assembly2.cif.gz_B crystal structure of the phosphatidylinositol 4-kinase iibeta 0.7305 52 219
8a5x-assembly1.cif.gz_A crystal structure of phosphatidyl inositol 4-kinase ii beta in complex with mm1373 0.7272 59 219
4hne-assembly1.cif.gz_B crystal structure of the catalytic domain of human type ii alpha phosphatidylinositol 4-kinase (pi4kiialpha) in complex with adp 0.7163 19 219
4pla-assembly1.cif.gz_A crystal structure of phosphatidyl inositol 4-kinase ii alpha in complex with atp 0.7141 56 219
4yc4-assembly1.cif.gz_A crystal structure of phosphatidyl inositol 4-kinase ii alpha in complex with nucleotide analog 0.6954 49 222
ID Description Score Start End Superfamily
af_O06242_7_252_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8604 17 222 3.10.450.50
af_O06242_7_252_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.762 17 222 3.10.450.50
af_Q20019_93_358_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.7113 15 43 3.90.190.10
af_Q9BTU6_133_431_1.10.1070.11 Mainly Alpha;Orthogonal Bundle;Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, Domain 5;Phosphatidylinositol 3-/4-kinase, catalytic domain 0.6681 34 212 1.10.1070.11
af_Q9TW27_328_406_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.6667 14 43 3.30.160.20
ID Description Score Start End GO Terms
AF-A0A2W6CB68-F1-model_v4 Phosphatidylinositol kinase 0.9375 1 97 GO:0016301
AF-A0A1F8KJD7-F1-model_v4 PI3K/PI4K catalytic domain-containing protein 0.9336 5 233
AF-A0A3D3YXF8-F1-model_v4 SCO1664 family protein 0.9271 8 233
AF-A0A7C4PUC4-F1-model_v4 SCO1664 family protein 0.9256 5 233
AF-A0A523BZE0-F1-model_v4 PI3K/PI4K catalytic domain-containing protein 0.924 8 233

Map