F239535

General Info

Members Datasets Scaffolds Average Seq Length
162 122 162 186

Family's Representative Sequence

Representative Sequence 3300028556|Ga0265337_1011317|Ga0265337_10113173
Length 224
Sequence MGLESIREIIFIQIPGLWCLSIETVTGCEQSNWCEALYEAKAAQLILYGRALGLTHGEAEDVLQETFLVLLKMVAPPLGRMPLEPEHYCVRSFRNRALNHRRSLWRRLTRELESLRWFEKSPGETEAERAAMNCLAGLPVEQREAIVLKIWHRFTFEEIGGLLGISPNTAAGRYRYGLQKIKHRLEGIDYGRERNEITGEPAAFLASAPGVGDAYVAVAAGARR

Samples

Sample ID Description Type Environment
1 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
57 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
60 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
61 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
62 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
63 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
64 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
65 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
66 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
67 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
68 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
69 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
70 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
71 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
72 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
73 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
74 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
75 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
76 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
77 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
78 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
79 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
80 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
81 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
82 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
84 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
85 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
86 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
87 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
88 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
89 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
90 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
91 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
92 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
93 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
94 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
95 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
96 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
97 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
98 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
99 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
100 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
101 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
102 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
103 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
104 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
105 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
106 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
107 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
108 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
113 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
114 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
115 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
116 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
119 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
120 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
121 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
122 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0.62
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.62
Nodule 0
Rhizoplane 1.23
Rhizosphere 97.53
Stem 0
Stem Tuber 0
Unclassified 0.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058860_11782633 3300004801 Unclassified 668
2 Ga0070690_100007016 3300005330 Bacteria 6423
3 Ga0068869_101049895 3300005334 Bacteria 711
4 Ga0070689_100009370 3300005340 Bacteria 6938
5 Ga0070689_100193438 3300005340 Bacteria 1657
6 Ga0070675_100192164 3300005354 Bacteria 1769
7 Ga0070688_100089426 3300005365 Bacteria 2009
8 Ga0070688_100858318 3300005365 Unclassified 713
9 Ga0070714_100771400 3300005435 Bacteria 930
10 Ga0070701_10679415 3300005438 Unclassified 690
11 Ga0070711_100055412 3300005439 Bacteria 2739
12 Ga0070705_100507802 3300005440 Bacteria 916
13 Ga0070700_100648875 3300005441 Unclassified 833
14 Ga0070694_100369099 3300005444 Bacteria 1116
15 Ga0070685_10125339 3300005466 Unclassified 1599
16 Ga0070679_100419121 3300005530 Bacteria 1284
17 Ga0070684_100469909 3300005535 Bacteria 1163
18 Ga0070686_100016907 3300005544 Bacteria 4251
19 Ga0070704_100069345 3300005549 Bacteria 2554
20 Ga0068857_100006991 3300005577 Bacteria 9709
21 Ga0068857_100277486 3300005577 Bacteria 1541
22 Ga0068856_100679349 3300005614 Bacteria 1050
23 Ga0068859_100029964 3300005617 Bacteria 5459
24 Ga0068864_100063411 3300005618 Bacteria 3202
25 Ga0068861_101304742 3300005719 Unclassified 706
26 Ga0068858_100194761 3300005842 Bacteria 1915
27 Ga0068862_100396496 3300005844 Bacteria 1290
28 Ga0081455_10617443 3300005937 Unclassified 704
29 Ga0097621_100762746 3300006237 Unclassified 894
30 Ga0075428_100002301 3300006844 Bacteria 20676
31 Ga0075428_100220540 3300006844 Bacteria 2048
32 Ga0075428_100363191 3300006844 Archaea 1553
33 Ga0075431_100123622 3300006847 Bacteria 2670
34 Ga0075429_100171523 3300006880 Archaea 1900
35 Ga0097620_100029964 3300006931 Bacteria 5459
36 Ga0099794_10163210 3300007265 Unclassified 1134
37 Ga0111539_10024767 3300009094 Bacteria 7360
38 Ga0111539_10476429 3300009094 Archaea 1454
39 Ga0105242_10491565 3300009176 Bacteria 1165
40 Ga0105248_11269089 3300009177 Unclassified 833
41 Ga0105238_10025732 3300009551 Bacteria 6000
42 Ga0105238_10141528 3300009551 Bacteria 2382
43 Ga0105249_10149658 3300009553 Bacteria 2246
44 Ga0105249_10869573 3300009553 Bacteria 968
45 Ga0099796_10185570 3300010159 Unclassified 837
46 Ga0157370_10081965 3300013104 Bacteria 3035
47 Ga0163162_11188583 3300013306 Unclassified 865
48 Ga0163163_10000045 3300014325 Bacteria 135325
49 Ga0163163_10086219 3300014325 Bacteria 3149
50 Ga0163163_10357283 3300014325 Unclassified 1517
51 Ga0163163_10677697 3300014325 Bacteria 1095
52 Ga0157379_11347719 3300014968 Unclassified 690
53 Ga0157376_10086905 3300014969 Unclassified 2697
54 Ga0157376_10112402 3300014969 Bacteria 2400
55 Ga0157376_10467780 3300014969 Unclassified 1233
56 Ga0157376_10908906 3300014969 Unclassified 899
57 Ga0207695_10329509 3300025913 Bacteria 1415
58 Ga0207663_10041545 3300025916 Bacteria 2803
59 Ga0207662_10137215 3300025918 Bacteria 1547
60 Ga0207694_10099599 3300025924 Bacteria 2302
61 Ga0207664_10585407 3300025929 Bacteria 1002
62 Ga0207686_10501527 3300025934 Unclassified 942
63 Ga0207670_10005494 3300025936 Bacteria 6965
64 Ga0207667_10037862 3300025949 Bacteria 5155
65 Ga0207703_10604307 3300026035 Bacteria 1038
66 Ga0207702_10016135 3300026078 Bacteria 6183
67 Ga0207641_11416363 3300026088 Unclassified 696
68 Ga0207676_10128589 3300026095 Bacteria 2150
69 Ga0207674_10012922 3300026116 Bacteria 9311
70 Ga0207428_10341792 3300027907 Bacteria 1102
71 Ga0207428_10400851 3300027907 Bacteria 1004
72 Ga0268265_10067292 3300028380 Bacteria 2773
73 Ga0268264_10795767 3300028381 Unclassified 944
74 Ga0265337_1008739 3300028556 Bacteria 3657
75 Ga0265337_1009501 3300028556 Bacteria 3468
76 Ga0265337_1011317 3300028556 Unclassified 3079
77 Ga0265319_1000016 3300028563 Bacteria 176245
78 Ga0265322_10021869 3300028654 Bacteria 1832
79 Ga0265336_10024915 3300028666 Bacteria 1886
80 Ga0265336_10126792 3300028666 Unclassified 760
81 Ga0265338_10034022 3300028800 Unclassified 4935
82 Ga0265338_10057917 3300028800 Unclassified 3424
83 Ga0265338_10084867 3300028800 Bacteria 2642
84 Ga0265338_10104023 3300028800 Bacteria 2305
85 Ga0265324_10169721 3300029957 Bacteria 741
86 Ga0265328_10040876 3300031239 Bacteria 1708
87 Ga0265320_10002885 3300031240 Bacteria 11789
88 Ga0265320_10039482 3300031240 Unclassified 2360
89 Ga0265329_10004265 3300031242 Bacteria 6003
90 Ga0265339_10198494 3300031249 Bacteria 991
91 Ga0265316_10122618 3300031344 Unclassified 1962
92 Ga0265316_10544875 3300031344 Unclassified 826
93 Ga0265313_10011429 3300031595 Bacteria 5522
94 Ga0265314_10001100 3300031711 Bacteria 31213
95 Ga0265314_10015977 3300031711 Bacteria 5944
96 Ga0265314_10035409 3300031711 Bacteria 3639
97 Ga0307411_11380533 3300032005 Unclassified 644
98 Ga0373926_0016361 3300035083 Bacteria 2535
99 Ga0373944_0164842 3300035089 Unclassified 788
100 Ga0373954_0056493 3300035118 Unclassified 1847
101 Ga0373954_0296479 3300035118 Unclassified 797
102 Ga0373956_0144607 3300035119 Bacteria 1117
103 Ga0373931_0127910 3300035691 Unclassified 1459
104 Ga0373935_0028356 3300035692 Bacteria 3461
105 Ga0373927_0008887 3300035695 Bacteria 6746
106 Ga0373927_0434180 3300035695 Bacteria 867
107 Ga0373933_0112307 3300035724 Bacteria 1701
108 Ga0373933_0538024 3300035724 Unclassified 766
109 Ga0373947_0040852 3300035725 Bacteria 2764
110 Ga0373937_0125291 3300036401 Bacteria 2396
111 Ga0373925_0007974 3300037068 Bacteria 7711
112 Ga0373925_0142609 3300037068 Bacteria 1876
113 Ga0451577_0197143 3300042876 Bacteria 1817
114 Ga0451577_0608264 3300042876 Unclassified 992
115 Ga0453684_0001256 3300044712 Bacteria 76375
116 Ga0453684_0327175 3300044712 Bacteria 1734
117 Ga0453684_1296837 3300044712 Unclassified 760
118 Ga0451576_0140488 3300045051 Bacteria 2519
119 Ga0451576_1029173 3300045051 Bacteria 863
120 Ga0495592_0000012 3300046454 Bacteria 154054
121 Ga0495582_0116179 3300046473 Bacteria 1505
122 Ga0495662_0226077 3300046476 Bacteria 922
123 Ga0495664_0423686 3300046477 Bacteria 798
124 Ga0495618_0002124 3300046514 Bacteria 12985
125 Ga0495628_0000320 3300046516 Bacteria 43366
126 Ga0495630_0000010 3300046517 Bacteria 265324
127 Ga0495666_0036179 3300046526 Bacteria 2405
128 Ga0495652_0106334 3300046529 Unclassified 2266
129 Ga0495640_0083907 3300046533 Unclassified 2114
130 Ga0495586_0000048 3300046535 Bacteria 71629
131 Ga0495586_0000867 3300046535 Bacteria 17339
132 Ga0495621_0143982 3300046539 Unclassified 934
133 Ga0495634_0125052 3300046642 Bacteria 1644
134 Ga0495599_0008232 3300046678 Bacteria 6340
135 Ga0495658_0027223 3300046683 Bacteria 3073
136 Ga0495613_0607853 3300046689 Bacteria 727
137 Ga0495674_0159017 3300047319 Unclassified 1891
138 Ga0495676_0109400 3300047321 Bacteria 2031
139 Ga0495676_0257170 3300047321 Unclassified 1189
140 Ga0495684_0414913 3300047471 Unclassified 942
141 Ga0496112_1465420 3300048915 Unclassified 597
142 Ga0496115_0010040 3300048918 Bacteria 7056
143 Ga0501033_0455237 3300049570 Bacteria 888
144 Ga0501037_0064331 3300049573 Bacteria 2673
145 Ga0501043_0259899 3300049579 Bacteria 1336
146 Ga0501043_0908490 3300049579 Bacteria 631
147 Ga0501047_0260747 3300049581 Bacteria 1581
148 Ga0501070_0492993 3300049586 Bacteria 985
149 Ga0501073_0312021 3300049589 Bacteria 1085
150 Ga0501080_0108187 3300049742 Bacteria 2577
151 Ga0501083_0531544 3300049744 Unclassified 765
152 Ga0501035_0008625 3300049822 Bacteria 9485
153 Ga0501035_0136291 3300049822 Bacteria 2137
154 Ga0501044_0031577 3300049823 Bacteria 5574
155 Ga0501044_0171772 3300049823 Unclassified 2139
156 nmdc:mga09592_168884_c1 3300050508 Archaea 1891
157 nmdc:mga06r32_122076_c1 3300050510 Bacteria 2570
158 nmdc:mga08y16_1116473_c1 3300050511 Unclassified 763
159 nmdc:mga08y16_231942_c1 3300050511 Bacteria 1909
160 nmdc:mga08y16_8571_c1 3300050511 Bacteria 10713
161 nmdc:mga08x19_393777_c1 3300050514 Bacteria 971
162 Ga0500650_0019858 3300053098 Unclassified 2939

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005617 Ga0068859_100029964 Ga0068859_1000299642 161
2 3300005842 Ga0068858_100194761 Ga0068858_1001947612 161
3 3300006931 Ga0097620_100029964 Ga0097620_1000299643 161
4 3300026035 Ga0207703_10604307 Ga0207703_106043072 161
5 3300005937 Ga0081455_10617443 Ga0081455_106174431 171
6 3300042876 Ga0451577_0608264 Ga0451577_0608264_401_916 171
7 3300044712 Ga0453684_1296837 Ga0453684_1296837_141_656 171
8 3300005330 Ga0070690_100007016 Ga0070690_1000070164 174
9 3300048918 Ga0496115_0010040 Ga0496115_0010040_5402_5956 175
10 3300025949 Ga0207667_10037862 Ga0207667_100378623 176
11 3300005365 Ga0070688_100858318 Ga0070688_1008583182 177
12 3300014325 Ga0163163_10677697 Ga0163163_106776973 177
13 3300005340 Ga0070689_100009370 Ga0070689_1000093703 178
14 3300005354 Ga0070675_100192164 Ga0070675_1001921643 178
15 3300005365 Ga0070688_100089426 Ga0070688_1000894263 178
16 3300005466 Ga0070685_10125339 Ga0070685_101253393 178
17 3300005719 Ga0068861_101304742 Ga0068861_1013047421 178
18 3300006844 Ga0075428_100363191 Ga0075428_1003631913 178
19 3300006880 Ga0075429_100171523 Ga0075429_1001715233 178
20 3300009094 Ga0111539_10476429 Ga0111539_104764293 178
21 3300014325 Ga0163163_10357283 Ga0163163_103572832 178
22 3300025936 Ga0207670_10005494 Ga0207670_100054943 178
23 3300028556 Ga0265337_1008739 Ga0265337_10087391 178
24 3300028666 Ga0265336_10024915 Ga0265336_100249152 178
25 3300031240 Ga0265320_10002885 Ga0265320_100028859 178
26 3300037068 Ga0373925_0142609 Ga0373925_0142609_772_1341 178
27 3300049579 Ga0501043_0908490 Ga0501043_0908490_75_617 178
28 3300049744 Ga0501083_0531544 Ga0501083_0531544_100_642 178
29 3300050508 nmdc:mga09592_168884_c1 nmdc:mga09592_168884_c1_579_1115 178
30 3300050511 nmdc:mga08y16_1116473_c1 nmdc:mga08y16_1116473_c1_157_693 178
31 3300032005 Ga0307411_11380533 Ga0307411_113805331 179
32 3300005334 Ga0068869_101049895 Ga0068869_1010498951 180
33 3300005435 Ga0070714_100771400 Ga0070714_1007714002 180
34 3300025929 Ga0207664_10585407 Ga0207664_105854071 180
35 3300026088 Ga0207641_11416363 Ga0207641_114163632 180
36 3300005530 Ga0070679_100419121 Ga0070679_1004191213 181
37 3300009551 Ga0105238_10025732 Ga0105238_100257328 181
38 3300026078 Ga0207702_10016135 Ga0207702_100161358 181
39 3300028381 Ga0268264_10795767 Ga0268264_107957672 181
40 3300028800 Ga0265338_10057917 Ga0265338_100579173 181
41 3300005438 Ga0070701_10679415 Ga0070701_106794151 182
42 3300005441 Ga0070700_100648875 Ga0070700_1006488751 182
43 3300006844 Ga0075428_100002301 Ga0075428_10000230113 182
44 3300006844 Ga0075428_100220540 Ga0075428_1002205404 182
45 3300006847 Ga0075431_100123622 Ga0075431_1001236223 182
46 3300007265 Ga0099794_10163210 Ga0099794_101632101 182
47 3300009094 Ga0111539_10024767 Ga0111539_100247673 182
48 3300025913 Ga0207695_10329509 Ga0207695_103295092 182
49 3300027907 Ga0207428_10341792 Ga0207428_103417922 182
50 3300027907 Ga0207428_10400851 Ga0207428_104008512 182
51 3300031711 Ga0265314_10015977 Ga0265314_100159772 182
52 3300042876 Ga0451577_0197143 Ga0451577_0197143_862_1449 182
53 3300044712 Ga0453684_0001256 Ga0453684_0001256_68423_69010 182
54 3300046516 Ga0495628_0000320 Ga0495628_0000320_29287_29835 182
55 3300049589 Ga0501073_0312021 Ga0501073_0312021_278_832 182
56 3300050510 nmdc:mga06r32_122076_c1 nmdc:mga06r32_122076_c1_1332_1880 182
57 3300050511 nmdc:mga08y16_231942_c1 nmdc:mga08y16_231942_c1_1182_1730 182
58 3300050511 nmdc:mga08y16_8571_c1 nmdc:mga08y16_8571_c1_4169_4717 182
59 3300053098 Ga0500650_0019858 Ga0500650_0019858_1090_1638 182
60 3300004801 Ga0058860_11782633 Ga0058860_117826331 183
61 3300005340 Ga0070689_100193438 Ga0070689_1001934382 183
62 3300005439 Ga0070711_100055412 Ga0070711_1000554122 183
63 3300005440 Ga0070705_100507802 Ga0070705_1005078021 183
64 3300005444 Ga0070694_100369099 Ga0070694_1003690991 183
65 3300005535 Ga0070684_100469909 Ga0070684_1004699093 183
66 3300005544 Ga0070686_100016907 Ga0070686_1000169071 183
67 3300005549 Ga0070704_100069345 Ga0070704_1000693453 183
68 3300005577 Ga0068857_100006991 Ga0068857_1000069917 183
69 3300005577 Ga0068857_100277486 Ga0068857_1002774862 183
70 3300005614 Ga0068856_100679349 Ga0068856_1006793491 183
71 3300005618 Ga0068864_100063411 Ga0068864_1000634113 183
72 3300005844 Ga0068862_100396496 Ga0068862_1003964962 183
73 3300006237 Ga0097621_100762746 Ga0097621_1007627462 183
74 3300009176 Ga0105242_10491565 Ga0105242_104915652 183
75 3300009177 Ga0105248_11269089 Ga0105248_112690892 183
76 3300009551 Ga0105238_10141528 Ga0105238_101415283 183
77 3300009553 Ga0105249_10149658 Ga0105249_101496583 183
78 3300009553 Ga0105249_10869573 Ga0105249_108695732 183
79 3300010159 Ga0099796_10185570 Ga0099796_101855701 183
80 3300013104 Ga0157370_10081965 Ga0157370_100819653 183
81 3300013306 Ga0163162_11188583 Ga0163162_111885831 183
82 3300014325 Ga0163163_10000045 Ga0163163_1000004536 183
83 3300014325 Ga0163163_10086219 Ga0163163_100862193 183
84 3300014968 Ga0157379_11347719 Ga0157379_113477191 183
85 3300014969 Ga0157376_10086905 Ga0157376_100869053 183
86 3300014969 Ga0157376_10112402 Ga0157376_101124023 183
87 3300014969 Ga0157376_10467780 Ga0157376_104677802 183
88 3300014969 Ga0157376_10908906 Ga0157376_109089061 183
89 3300025916 Ga0207663_10041545 Ga0207663_100415453 183
90 3300025918 Ga0207662_10137215 Ga0207662_101372152 183
91 3300025924 Ga0207694_10099599 Ga0207694_100995993 183
92 3300025934 Ga0207686_10501527 Ga0207686_105015272 183
93 3300026095 Ga0207676_10128589 Ga0207676_101285892 183
94 3300026116 Ga0207674_10012922 Ga0207674_100129226 183
95 3300028380 Ga0268265_10067292 Ga0268265_100672923 183
96 3300028556 Ga0265337_1009501 Ga0265337_10095013 183
97 3300028556 Ga0265337_1011317 Ga0265337_10113173 183
98 3300028563 Ga0265319_1000016 Ga0265319_100001657 183
99 3300028654 Ga0265322_10021869 Ga0265322_100218692 183
100 3300028666 Ga0265336_10126792 Ga0265336_101267922 183
101 3300028800 Ga0265338_10034022 Ga0265338_100340223 183
102 3300028800 Ga0265338_10084867 Ga0265338_100848673 183
103 3300028800 Ga0265338_10104023 Ga0265338_101040231 183
104 3300029957 Ga0265324_10169721 Ga0265324_101697211 183
105 3300031239 Ga0265328_10040876 Ga0265328_100408762 183
106 3300031240 Ga0265320_10039482 Ga0265320_100394823 183
107 3300031242 Ga0265329_10004265 Ga0265329_100042652 183
108 3300031249 Ga0265339_10198494 Ga0265339_101984942 183
109 3300031344 Ga0265316_10122618 Ga0265316_101226183 183
110 3300031344 Ga0265316_10544875 Ga0265316_105448751 183
111 3300031595 Ga0265313_10011429 Ga0265313_100114293 183
112 3300031711 Ga0265314_10001100 Ga0265314_1000110017 183
113 3300031711 Ga0265314_10035409 Ga0265314_100354094 183
114 3300035083 Ga0373926_0016361 Ga0373926_0016361_1898_2464 183
115 3300035089 Ga0373944_0164842 Ga0373944_0164842_35_658 183
116 3300035118 Ga0373954_0056493 Ga0373954_0056493_651_1202 183
117 3300035118 Ga0373954_0296479 Ga0373954_0296479_188_739 183
118 3300035119 Ga0373956_0144607 Ga0373956_0144607_97_648 183
119 3300035691 Ga0373931_0127910 Ga0373931_0127910_663_1220 183
120 3300035692 Ga0373935_0028356 Ga0373935_0028356_2496_3062 183
121 3300035695 Ga0373927_0008887 Ga0373927_0008887_1758_2324 183
122 3300035695 Ga0373927_0434180 Ga0373927_0434180_45_596 183
123 3300035724 Ga0373933_0112307 Ga0373933_0112307_20_571 183
124 3300035724 Ga0373933_0538024 Ga0373933_0538024_25_576 183
125 3300035725 Ga0373947_0040852 Ga0373947_0040852_1602_2168 183
126 3300036401 Ga0373937_0125291 Ga0373937_0125291_1697_2248 183
127 3300037068 Ga0373925_0007974 Ga0373925_0007974_1161_1727 183
128 3300044712 Ga0453684_0327175 Ga0453684_0327175_902_1483 183
129 3300045051 Ga0451576_0140488 Ga0451576_0140488_1431_1985 183
130 3300045051 Ga0451576_1029173 Ga0451576_1029173_47_661 183
131 3300046454 Ga0495592_0000012 Ga0495592_0000012_124815_125375 183
132 3300046473 Ga0495582_0116179 Ga0495582_0116179_599_1150 183
133 3300046476 Ga0495662_0226077 Ga0495662_0226077_40_600 183
134 3300046477 Ga0495664_0423686 Ga0495664_0423686_107_667 183
135 3300046514 Ga0495618_0002124 Ga0495618_0002124_6691_7251 183
136 3300046517 Ga0495630_0000010 Ga0495630_0000010_121897_122448 183
137 3300046526 Ga0495666_0036179 Ga0495666_0036179_223_789 183
138 3300046529 Ga0495652_0106334 Ga0495652_0106334_109_669 183
139 3300046533 Ga0495640_0083907 Ga0495640_0083907_602_1162 183
140 3300046535 Ga0495586_0000048 Ga0495586_0000048_43593_44144 183
141 3300046535 Ga0495586_0000867 Ga0495586_0000867_15914_16474 183
142 3300046539 Ga0495621_0143982 Ga0495621_0143982_241_798 183
143 3300046642 Ga0495634_0125052 Ga0495634_0125052_275_835 183
144 3300046678 Ga0495599_0008232 Ga0495599_0008232_5597_6157 183
145 3300046683 Ga0495658_0027223 Ga0495658_0027223_1265_1888 183
146 3300046689 Ga0495613_0607853 Ga0495613_0607853_98_649 183
147 3300047319 Ga0495674_0159017 Ga0495674_0159017_950_1510 183
148 3300047321 Ga0495676_0109400 Ga0495676_0109400_347_898 183
149 3300047321 Ga0495676_0257170 Ga0495676_0257170_57_623 183
150 3300047471 Ga0495684_0414913 Ga0495684_0414913_365_916 183
151 3300048915 Ga0496112_1465420 Ga0496112_1465420_15_566 183
152 3300049570 Ga0501033_0455237 Ga0501033_0455237_143_694 183
153 3300049573 Ga0501037_0064331 Ga0501037_0064331_1085_1636 183
154 3300049579 Ga0501043_0259899 Ga0501043_0259899_50_601 183
155 3300049581 Ga0501047_0260747 Ga0501047_0260747_239_790 183
156 3300049586 Ga0501070_0492993 Ga0501070_0492993_331_882 183
157 3300049742 Ga0501080_0108187 Ga0501080_0108187_1683_2240 183
158 3300049822 Ga0501035_0008625 Ga0501035_0008625_5854_6405 183
159 3300049822 Ga0501035_0136291 Ga0501035_0136291_478_1035 183
160 3300049823 Ga0501044_0031577 Ga0501044_0031577_2861_3412 183
161 3300049823 Ga0501044_0171772 Ga0501044_0171772_1424_2059 183
162 3300050514 nmdc:mga08x19_393777_c1 nmdc:mga08x19_393777_c1_26_577 183

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04545

Sigma70_r4

Sigma-70, region 4

134

183

0.98

PF08281

Sigma70_r4_2

Sigma-70, region 4

128

181

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o8x-assembly1.cif.gz_A "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.992 102 152
2o8x-assembly1.cif.gz_B "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9892 102 152
3hug-assembly2.cif.gz_E crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.9869 98 160
7bhy-assembly1.cif.gz_A dna-binding domain of deor in complex with the dna operator 0.9806 112 151
7bhy-assembly1.cif.gz_B dna-binding domain of deor in complex with the dna operator 0.9796 112 151
ID Description Score Start End Superfamily
2o8xA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.992 102 152 1.10.10.10
2o8xC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9912 104 152 1.10.10.10
2o8xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9892 102 152 1.10.10.10
3hugG00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9752 98 158 1.10.10.10
3hugO00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9741 98 158 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A6N6PZA8-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.8651 1 155 GO:0003677
GO:0006352
GO:0016987
AF-A0A1K1PND6-F1-model_v4 RNA polymerase sigma-70 factor, ECF subfamily 0.8523 6 164 GO:0003677
GO:0005737
GO:0006352
GO:0016987
AF-A0A177QMC6-F1-model_v4 deleted 0.8491 12 157
AF-A0A255QQF8-F1-model_v4 RNA polymerase subunit sigma-70 0.8334 10 166 GO:0003677
GO:0006352
GO:0016987
AF-A0A2V4WBD9-F1-model_v4 deleted 0.8279 1 161

Feature Viewer

pLDDT pTM Quality
78.76 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map