F239427

General Info

Members Datasets Scaffolds Average Seq Length
162 110 324 272

Family's Representative Sequence

Representative Sequence 3300025912|Ga0207707_10036384|Ga0207707_100363843
Length 316
Sequence VLWLNPGEEVQTTLVSEELLNIQFVCSCFIFCLKLEVSKFWRRLLETLGQSMKSILLSLSLLIAGSATAQDWAKAKIEKSPRHHEWVKVKHGDREVNCYVTYPEVKDKATAVIVIHEIYGMTDWARSVTDDLAEAGYIAIEPDLLSGMAPGGGGTAEMGGQDNATAAVSKLSPDQVTADLDAVAKYVSALPSCNGKIAVAGFCWGGGQAFRYATNNKDLKAAFVFYGTPPSEGDMARINCPVYGFYGGNDGRVTQTVPDATKQMKAANKTYEPVTYDGAGHGFMRMGEAEAPKASAANRKAHDEAWVRWKELLKKI

Samples

Sample ID Description Type Environment
1 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
65 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
66 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
67 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
68 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
69 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
70 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
71 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
72 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
73 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
74 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
75 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
76 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
77 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
78 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
79 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
80 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
81 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
82 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
83 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
84 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
85 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
86 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
90 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
91 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
92 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
93 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
94 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
95 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
96 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
97 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
98 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
99 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
100 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
101 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
102 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
103 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
104 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
106 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
107 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
108 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
109 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
110 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0.62
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.23
Nodule 0
Rhizoplane 0.62
Rhizosphere 98.15
Stem 0
Stem Tuber 0
Unclassified 17.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207707_10036384 3300025912 Bacteria 4305
2 Ga0065712_10195066 3300005290 Bacteria 1132
3 Ga0070683_100001155 3300005329 Bacteria 19993
4 Ga0070683_100222235 3300005329 Unclassified 1795
5 Ga0070690_100068104 3300005330 Unclassified 2308
6 Ga0070670_100261941 3300005331 Bacteria 1507
7 Ga0070670_100289764 3300005331 Bacteria 1430
8 Ga0070680_100031854 3300005336 Bacteria 4239
9 Ga0070689_100016615 3300005340 Bacteria 5387
10 Ga0070688_100195684 3300005365 Unclassified 1411
11 Ga0070659_100013817 3300005366 Bacteria 6022
12 Ga0070703_10000857 3300005406 Bacteria 9797
13 Ga0070709_10048145 3300005434 Bacteria 2659
14 Ga0070714_100469380 3300005435 Bacteria 1197
15 Ga0070713_100026361 3300005436 Bacteria 4562
16 Ga0070710_10012997 3300005437 Bacteria 4153
17 Ga0070705_100006254 3300005440 Bacteria 5833
18 Ga0070705_100314179 3300005440 Bacteria 1128
19 Ga0070708_100055895 3300005445 Bacteria 3510
20 Ga0070681_10019865 3300005458 Bacteria 6730
21 Ga0070681_10158928 3300005458 Bacteria 2184
22 Ga0070706_100000293 3300005467 Bacteria 60783
23 Ga0070699_100000004 3300005518 Bacteria 404262
24 Ga0070679_100118549 3300005530 Unclassified 2632
25 Ga0068853_100146176 3300005539 Unclassified 2125
26 Ga0070686_100026833 3300005544 Bacteria 3480
27 Ga0070686_100386440 3300005544 Unclassified 1061
28 Ga0070695_100102085 3300005545 Bacteria 1933
29 Ga0070696_100002224 3300005546 Bacteria 12786
30 Ga0070696_100443373 3300005546 Unclassified 1023
31 Ga0068855_100018404 3300005563 Bacteria 8394
32 Ga0068855_100092083 3300005563 Bacteria 3496
33 Ga0068855_100215713 3300005563 Bacteria 2154
34 Ga0068855_100229719 3300005563 Unclassified 2078
35 Ga0070664_100003300 3300005564 Bacteria 13034
36 Ga0068857_100016159 3300005577 Bacteria 6536
37 Ga0068857_100021041 3300005577 Bacteria 5739
38 Ga0068859_100962390 3300005617 Bacteria 937
39 Ga0068864_100016362 3300005618 Bacteria 6174
40 Ga0068863_100162815 3300005841 Bacteria 2138
41 Ga0068863_100783684 3300005841 Bacteria 950
42 Ga0070717_10156264 3300006028 Bacteria 1976
43 Ga0070716_100354906 3300006173 Unclassified 1039
44 Ga0070712_100273900 3300006175 Unclassified 1357
45 Ga0075434_100001057 3300006871 Bacteria 22474
46 Ga0097620_100069537 3300006931 Unclassified 3556
47 Ga0097620_100962388 3300006931 Bacteria 937
48 Ga0075435_100014351 3300007076 Bacteria 5918
49 Ga0075435_100099456 3300007076 Bacteria 2409
50 Ga0105240_10130988 3300009093 Unclassified 3008
51 Ga0105240_10212887 3300009093 Bacteria 2257
52 Ga0111539_10252293 3300009094 Bacteria 2054
53 Ga0105238_10044337 3300009551 Bacteria 4497
54 Ga0157373_10008288 3300013100 Bacteria 7722
55 Ga0157374_10136486 3300013296 Bacteria 2378
56 Ga0157374_10515054 3300013296 Bacteria 1202
57 Ga0157378_10115575 3300013297 Bacteria 2466
58 Ga0157372_10111506 3300013307 Bacteria 3134
59 Ga0157372_10681817 3300013307 Unclassified 1196
60 Ga0157375_10000086 3300013308 Bacteria 93377
61 Ga0157375_10168450 3300013308 Unclassified 2337
62 Ga0163163_10000126 3300014325 Bacteria 79511
63 Ga0163163_10075657 3300014325 Bacteria 3360
64 Ga0163163_10086448 3300014325 Bacteria 3145
65 Ga0163163_10224208 3300014325 Unclassified 1929
66 Ga0157379_10254368 3300014968 Bacteria 1595
67 Ga0207653_10000106 3300025885 Bacteria 59126
68 Ga0207684_10000293 3300025910 Bacteria 71834
69 Ga0207695_10114739 3300025913 Unclassified 2668
70 Ga0207693_10182380 3300025915 Bacteria 1652
71 Ga0207693_10268974 3300025915 Unclassified 1336
72 Ga0207660_10032940 3300025917 Bacteria 3580
73 Ga0207694_10121203 3300025924 Unclassified 2088
74 Ga0207700_10091413 3300025928 Bacteria 2404
75 Ga0207690_10033287 3300025932 Bacteria 3313
76 Ga0207670_10010498 3300025936 Bacteria 5341
77 Ga0207661_10037173 3300025944 Bacteria 3806
78 Ga0207679_10021247 3300025945 Bacteria 4397
79 Ga0207667_10003649 3300025949 Bacteria 18978
80 Ga0207667_10095519 3300025949 Bacteria 3069
81 Ga0207667_10284321 3300025949 Unclassified 1690
82 Ga0207708_10591648 3300026075 Bacteria 939
83 Ga0207702_10057697 3300026078 Unclassified 3301
84 Ga0207641_10105701 3300026088 Bacteria 2487
85 Ga0207676_10017265 3300026095 Bacteria 5231
86 Ga0207674_10004909 3300026116 Bacteria 15993
87 Ga0207674_10010591 3300026116 Bacteria 10432
88 Ga0265337_1000590 3300028556 Bacteria 19084
89 Ga0265337_1029812 3300028556 Bacteria 1629
90 Ga0265326_10023074 3300028558 Bacteria 1779
91 Ga0265319_1028637 3300028563 Bacteria 1962
92 Ga0265334_10007405 3300028573 Bacteria 4707
93 Ga0265318_10009005 3300028577 Bacteria 4415
94 Ga0265323_10002089 3300028653 Bacteria 9335
95 Ga0265323_10025424 3300028653 Bacteria 2242
96 Ga0265323_10095665 3300028653 Bacteria 988
97 Ga0265322_10001721 3300028654 Bacteria 6939
98 Ga0265338_10005290 3300028800 Bacteria 16896
99 Ga0265338_10006276 3300028800 Bacteria 15204
100 Ga0265338_10016556 3300028800 Bacteria 8008
101 Ga0265338_10019753 3300028800 Bacteria 7124
102 Ga0265338_10030158 3300028800 Bacteria 5353
103 Ga0265338_10041406 3300028800 Bacteria 4307
104 Ga0265338_10210967 3300028800 Bacteria 1458
105 Ga0265338_10281356 3300028800 Unclassified 1215
106 Ga0265330_10000946 3300031235 Bacteria 17895
107 Ga0265332_10018814 3300031238 Bacteria 3050
108 Ga0265332_10019008 3300031238 Bacteria 3034
109 Ga0265328_10008783 3300031239 Bacteria 4145
110 Ga0265328_10013863 3300031239 Bacteria 3181
111 Ga0265328_10031276 3300031239 Bacteria 1978
112 Ga0265320_10003247 3300031240 Bacteria 10991
113 Ga0265320_10030932 3300031240 Bacteria 2754
114 Ga0265325_10011299 3300031241 Bacteria 5130
115 Ga0265329_10004688 3300031242 Bacteria 5636
116 Ga0265329_10026088 3300031242 Bacteria 1929
117 Ga0265340_10118948 3300031247 Unclassified 1216
118 Ga0265339_10000003 3300031249 Bacteria 305994
119 Ga0265339_10046763 3300031249 Bacteria 2377
120 Ga0265331_10077372 3300031250 Bacteria 1550
121 Ga0265327_10000769 3300031251 Bacteria 49436
122 Ga0265316_10008923 3300031344 Bacteria 9255
123 Ga0265316_10017852 3300031344 Bacteria 6116
124 Ga0265316_10065554 3300031344 Bacteria 2812
125 Ga0265316_10103724 3300031344 Unclassified 2159
126 Ga0265313_10004262 3300031595 Bacteria 11082
127 Ga0265314_10000063 3300031711 Bacteria 159305
128 Ga0265314_10000263 3300031711 Bacteria 76905
129 Ga0265314_10013620 3300031711 Bacteria 6559
130 Ga0265342_10001287 3300031712 Bacteria 23577
131 Ga0265342_10001853 3300031712 Bacteria 19121
132 Ga0265342_10008473 3300031712 Bacteria 7366
133 Ga0316593_10090705 3300032168 Bacteria 1076
134 Ga0373940_0082651 3300035088 Unclassified 952
135 Ga0373937_0672548 3300036401 Bacteria 981
136 Ga0436361_0417107 3300039447 Bacteria 1145
137 Ga0453684_0020490 3300044712 Bacteria 9967
138 Ga0453684_0043978 3300044712 Bacteria 5988
139 Ga0466959_0416936 3300045049 Bacteria 912
140 Ga0451576_0114774 3300045051 Bacteria 2804
141 Ga0451576_0185308 3300045051 Bacteria 2174
142 Ga0451576_0367738 3300045051 Bacteria 1506
143 Ga0451576_0571642 3300045051 Unclassified 1188
144 Ga0495628_0000269 3300046516 Bacteria 46574
145 Ga0495630_0000126 3300046517 Bacteria 60933
146 Ga0495666_0009034 3300046526 Unclassified 4987
147 Ga0495640_0118242 3300046533 Bacteria 1725
148 Ga0495586_0000913 3300046535 Bacteria 16828
149 Ga0495599_0096051 3300046678 Bacteria 1848
150 Ga0495599_0108803 3300046678 Bacteria 1727
151 Ga0495613_0060531 3300046689 Unclassified 2773
152 Ga0495674_0071693 3300047319 Unclassified 2989
153 Ga0495675_0092646 3300047444 Bacteria 1896
154 Ga0495686_0008096 3300047472 Bacteria 7775
155 Ga0496105_0121496 3300048908 Bacteria 2153
156 Ga0501033_0094611 3300049570 Bacteria 2185
157 Ga0501044_0059499 3300049823 Bacteria 3914
158 nmdc:mga08y16_350546_c1 3300050511 Bacteria 1516
159 nmdc:mga0n895_3857_c1 3300050512 Bacteria 12170
160 nmdc:mga0rr50_16445_c1 3300050513 Bacteria 4915
161 Ga0500650_0041289 3300053098 Bacteria 2129
162 Ga0500636_0192846 3300053177 Bacteria 1084
163 Ga0207707_10036384
164 Ga0065712_10195066
165 Ga0070683_100001155
166 Ga0070683_100222235
167 Ga0070690_100068104
168 Ga0070670_100261941
169 Ga0070670_100289764
170 Ga0070680_100031854
171 Ga0070689_100016615
172 Ga0070688_100195684
173 Ga0070659_100013817
174 Ga0070703_10000857
175 Ga0070709_10048145
176 Ga0070714_100469380
177 Ga0070713_100026361
178 Ga0070710_10012997
179 Ga0070705_100006254
180 Ga0070705_100314179
181 Ga0070708_100055895
182 Ga0070681_10019865
183 Ga0070681_10158928
184 Ga0070706_100000293
185 Ga0070699_100000004
186 Ga0070679_100118549
187 Ga0068853_100146176
188 Ga0070686_100026833
189 Ga0070686_100386440
190 Ga0070695_100102085
191 Ga0070696_100002224
192 Ga0070696_100443373
193 Ga0068855_100018404
194 Ga0068855_100092083
195 Ga0068855_100215713
196 Ga0068855_100229719
197 Ga0070664_100003300
198 Ga0068857_100016159
199 Ga0068857_100021041
200 Ga0068859_100962390
201 Ga0068864_100016362
202 Ga0068863_100162815
203 Ga0068863_100783684
204 Ga0070717_10156264
205 Ga0070716_100354906
206 Ga0070712_100273900
207 Ga0075434_100001057
208 Ga0097620_100069537
209 Ga0097620_100962388
210 Ga0075435_100014351
211 Ga0075435_100099456
212 Ga0105240_10130988
213 Ga0105240_10212887
214 Ga0111539_10252293
215 Ga0105238_10044337
216 Ga0157373_10008288
217 Ga0157374_10136486
218 Ga0157374_10515054
219 Ga0157378_10115575
220 Ga0157372_10111506
221 Ga0157372_10681817
222 Ga0157375_10000086
223 Ga0157375_10168450
224 Ga0163163_10000126
225 Ga0163163_10075657
226 Ga0163163_10086448
227 Ga0163163_10224208
228 Ga0157379_10254368
229 Ga0207653_10000106
230 Ga0207684_10000293
231 Ga0207695_10114739
232 Ga0207693_10182380
233 Ga0207693_10268974
234 Ga0207660_10032940
235 Ga0207694_10121203
236 Ga0207700_10091413
237 Ga0207690_10033287
238 Ga0207670_10010498
239 Ga0207661_10037173
240 Ga0207679_10021247
241 Ga0207667_10003649
242 Ga0207667_10095519
243 Ga0207667_10284321
244 Ga0207708_10591648
245 Ga0207702_10057697
246 Ga0207641_10105701
247 Ga0207676_10017265
248 Ga0207674_10004909
249 Ga0207674_10010591
250 Ga0265337_1000590
251 Ga0265337_1029812
252 Ga0265326_10023074
253 Ga0265319_1028637
254 Ga0265334_10007405
255 Ga0265318_10009005
256 Ga0265323_10002089
257 Ga0265323_10025424
258 Ga0265323_10095665
259 Ga0265322_10001721
260 Ga0265338_10005290
261 Ga0265338_10006276
262 Ga0265338_10016556
263 Ga0265338_10019753
264 Ga0265338_10030158
265 Ga0265338_10041406
266 Ga0265338_10210967
267 Ga0265338_10281356
268 Ga0265330_10000946
269 Ga0265332_10018814
270 Ga0265332_10019008
271 Ga0265328_10008783
272 Ga0265328_10013863
273 Ga0265328_10031276
274 Ga0265320_10003247
275 Ga0265320_10030932
276 Ga0265325_10011299
277 Ga0265329_10004688
278 Ga0265329_10026088
279 Ga0265340_10118948
280 Ga0265339_10000003
281 Ga0265339_10046763
282 Ga0265331_10077372
283 Ga0265327_10000769
284 Ga0265316_10008923
285 Ga0265316_10017852
286 Ga0265316_10065554
287 Ga0265316_10103724
288 Ga0265313_10004262
289 Ga0265314_10000063
290 Ga0265314_10000263
291 Ga0265314_10013620
292 Ga0265342_10001287
293 Ga0265342_10001853
294 Ga0265342_10008473
295 Ga0316593_10090705
296 Ga0373940_0082651
297 Ga0373937_0672548
298 Ga0436361_0417107
299 Ga0453684_0020490
300 Ga0453684_0043978
301 Ga0466959_0416936
302 Ga0451576_0114774
303 Ga0451576_0185308
304 Ga0451576_0367738
305 Ga0451576_0571642
306 Ga0495628_0000269
307 Ga0495630_0000126
308 Ga0495666_0009034
309 Ga0495640_0118242
310 Ga0495586_0000913
311 Ga0495599_0096051
312 Ga0495599_0108803
313 Ga0495613_0060531
314 Ga0495674_0071693
315 Ga0495675_0092646
316 Ga0495686_0008096
317 Ga0496105_0121496
318 Ga0501033_0094611
319 Ga0501044_0059499
320 nmdc:mga08y16_350546_c1
321 nmdc:mga0n895_3857_c1
322 nmdc:mga0rr50_16445_c1
323 Ga0500650_0041289
324 Ga0500636_0192846

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

96

316

0.89

PF02129

Peptidase_S15

X-Pro dipeptidyl-peptidase (S15 family)

91

308

0.79

PF12695

Abhydrolase_5

Alpha/beta hydrolase family

175

304

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zv9-assembly6.cif.gz_F 2.00 angstrom resolution crystal structure of an uncharacterized protein from escherichia coli o157:h7 str. sakai 0.8876 48 295
4zv9-assembly6.cif.gz_F 2.00 angstrom resolution crystal structure of an uncharacterized protein from escherichia coli o157:h7 str. sakai 0.86 48 295
1ggv-assembly1.cif.gz_A crystal structure of the c123s mutant of dienelactone hydrolase (dlh) bound with the pms moiety of the protease inhibitor, phenylmethylsulfonyl fluoride (pmsf) 0.8434 57 296
7jiz-assembly1.cif.gz_B dienelactone hydrolase family protein scdlh from solimonas sp. k1w22b-7 0.8418 53 297
4u2b-assembly1.cif.gz_A crystal structure of dienelactone hydrolase (c123s) at 1.70 a resolution 0.8374 57 297
ID Description Score Start End Superfamily
4zv9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8977 48 295 3.40.50.1820
4zv9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8688 48 295 3.40.50.1820
af_O86353_1_230_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8431 56 297 3.40.50.1820
af_O86353_1_230_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8362 56 297 3.40.50.1820
af_A0A0R0FIF5_30_237_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8187 81 295 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A2V9RE90-F1-model_v4 Carboxymethylenebutenolidase 0.9858 78 293 GO:0016787
AF-A0A7Z9QZG5-F1-model_v4 Dienelactone hydrolase domain-containing protein 0.9836 42 194 GO:0016787
AF-A0A2V9AX37-F1-model_v4 Carboxymethylenebutenolidase 0.9824 49 293 GO:0016787
AF-A0A2T2VTV9-F1-model_v4 Carboxymethylenebutenolidase 0.9798 47 294 GO:0016787
AF-A0A2V9RE90-F1-model_v4 Carboxymethylenebutenolidase 0.9764 78 293 GO:0016787

Map