F239008

General Info

Members Datasets Scaffolds Average Seq Length
162 124 324 299

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100005703|Ga0075428_1000057031
Length 319
Sequence VKIGMVGLGRMGGNMALRLGEKGHEVVGYDRHSPERKAASLPELVEQLDPPRVVWSMVPSGGPTEQVITELKGLLSPGDVIIDGGNSNWHDSVRRGQELAEAGLGFVDCGTSGGVWGREEGYCLMVGGRDEHVAYCQPLFDALKPPEGGFVHAGPVGTGHFTKMVHNGIEYGLMQAYAEGYELLARSGLGIDVEGALDAWRYGSVVRSWLLDLMVRALQAEPNLVGIRGYAADSGEGRWTVQEAVERGVATPVISAALFARFVSQQGDSLAMKAIAALRNQFGGHAVLPEDAPSRGEEPVEPPAGSGAATAGTHPEEPA

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
26 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
41 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
44 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
45 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
59 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
60 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
61 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
62 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
63 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
64 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
65 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
66 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
67 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
68 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
69 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
70 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
71 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
72 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
73 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
74 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
75 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
76 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
86 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
87 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
88 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
89 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
90 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
91 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
92 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
93 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
95 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
96 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
97 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
98 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
99 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
100 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
101 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
102 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
103 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
104 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
105 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
106 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
107 2643221613 Oerskovia sp. Root22 Isolate Unclassified
108 2643221616 Leifsonia sp. Root227 Isolate Unclassified
109 2643221649 Leifsonia sp. Root4 Isolate Unclassified
110 2643221721 Oerskovia sp. Root918 Isolate Unclassified
111 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
112 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
113 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
114 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
115 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
116 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
117 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
118 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
119 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
120 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
121 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
122 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
123 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
124 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.1
Metatranscriptomes 6.17
Isolates 11.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.17
Nodule 0
Rhizoplane 6.79
Rhizosphere 76.54
Stem 0
Stem Tuber 0.62
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100005703 3300006844 Bacteria 13843
2 CNXas_1000517 3300000545 Bacteria 2605
3 JGI24740J21852_10007366 3300001979 Bacteria 4478
4 JGI24743J22301_10019827 3300001991 Bacteria 1278
5 JGI24750J21931_1008957 3300002070 Bacteria 1281
6 JGI25162J39368_1007991 3300002737 Bacteria 1567
7 JGI25164J39214_1000299 3300002772 Bacteria 33711
8 JGI25406J46586_10000404 3300003203 Bacteria 19887
9 JGI25165J46597_1000005 3300003214 Bacteria 623702
10 Ga0070658_10000692 3300005327 Bacteria 29178
11 Ga0070658_10128976 3300005327 Bacteria 2106
12 Ga0070683_100298529 3300005329 Bacteria 1532
13 Ga0070680_100000823 3300005336 Bacteria 21895
14 Ga0070713_100010426 3300005436 Bacteria 6712
15 Ga0070678_100161744 3300005456 Bacteria 1815
16 Ga0070681_10001947 3300005458 Bacteria 18637
17 Ga0070679_100007867 3300005530 Bacteria 9996
18 Ga0070684_100067092 3300005535 Bacteria 3150
19 Ga0068855_100063072 3300005563 Bacteria 4326
20 Ga0070664_100059219 3300005564 Bacteria 3258
21 Ga0068864_100403615 3300005618 Bacteria 1299
22 Ga0081455_10025312 3300005937 Bacteria 5480
23 Ga0081540_1000517 3300005983 Bacteria 37840
24 Ga0075430_100002002 3300006846 Bacteria 16787
25 Ga0075430_100009368 3300006846 Bacteria 8278
26 Ga0075430_100049808 3300006846 Bacteria 3534
27 Ga0075430_100090450 3300006846 Bacteria 2560
28 Ga0075431_100000040 3300006847 Bacteria 67199
29 Ga0075431_100000972 3300006847 Bacteria 25462
30 Ga0075431_100092111 3300006847 Bacteria 3128
31 Ga0075431_100128657 3300006847 Bacteria 2613
32 Ga0075429_100000064 3300006880 Bacteria 52724
33 Ga0075429_100058159 3300006880 Bacteria 3367
34 Ga0105244_10027965 3300009036 Bacteria 3031
35 Ga0111539_10000426 3300009094 Bacteria 52948
36 Ga0114129_10013591 3300009147 Bacteria 11600
37 Ga0114129_10023131 3300009147 Bacteria 8815
38 Ga0114129_10096074 3300009147 Bacteria 4103
39 Ga0105243_10002105 3300009148 Bacteria 16839
40 Ga0105239_10283738 3300010375 Bacteria 1864
41 Ga0157369_10027609 3300013105 Bacteria 6289
42 Ga0157369_10083571 3300013105 Bacteria 3414
43 Ga0157369_10091792 3300013105 Bacteria 3241
44 Ga0157372_10041424 3300013307 Bacteria 5093
45 Ga0163163_10203823 3300014325 Bacteria 2026
46 Ga0163163_10332383 3300014325 Bacteria 1574
47 Ga0197907_10441761 3300020069 Bacteria 1636
48 Ga0197907_11294549 3300020069 Bacteria 1761
49 Ga0206356_10026423 3300020070 Bacteria 2103
50 Ga0206351_10905714 3300020077 Bacteria 1154
51 Ga0206352_10968830 3300020078 Bacteria 1445
52 Ga0206354_10114123 3300020081 Bacteria 2112
53 Ga0206354_11103434 3300020081 Bacteria 1479
54 Ga0206353_11444842 3300020082 Bacteria 5901
55 Ga0154015_1533751 3300020610 Bacteria 1830
56 Ga0224712_10055818 3300022467 Bacteria 1555
57 Ga0209563_100805 3300025230 Bacteria 9411
58 Ga0207427_100024 3300025231 Bacteria 438403
59 Ga0209437_100243 3300025233 Bacteria 88712
60 Ga0209233_1000001 3300025261 Bacteria 2992747
61 Ga0207705_10028384 3300025909 Bacteria 3989
62 Ga0207707_10001001 3300025912 Bacteria 27067
63 Ga0207660_10000704 3300025917 Bacteria 22296
64 Ga0207657_10053322 3300025919 Bacteria 3503
65 Ga0207652_10001354 3300025921 Bacteria 21776
66 Ga0207681_10359949 3300025923 Bacteria 1167
67 Ga0207709_10006994 3300025935 Bacteria 6306
68 Ga0207669_10047212 3300025937 Bacteria 2549
69 Ga0207691_10011568 3300025940 Bacteria 8473
70 Ga0207667_10036126 3300025949 Bacteria 5298
71 Ga0207674_10040194 3300026116 Bacteria 4847
72 Ga0268264_10039416 3300028381 Bacteria 3903
73 Ga0265327_10000001 3300031251 Bacteria 894475
74 Ga0265327_10000471 3300031251 Bacteria 71254
75 Ga0395900_0002809 3300037418 Bacteria 19013
76 Ga0395898_0673113 3300037466 Bacteria 977
77 Ga0400488_23359 3300038741 Bacteria 6312
78 Ga0451853_0175838 3300041512 Bacteria 4598
79 Ga0466970_0037048 3300044765 Bacteria 2584
80 Ga0466967_0012048 3300045976 Bacteria 6591
81 Ga0496102_0014042 3300048905 Bacteria 6955
82 Ga0496102_0146080 3300048905 Bacteria 2220
83 Ga0496104_0348368 3300048907 Bacteria 1394
84 Ga0496105_0277761 3300048908 Bacteria 1351
85 Ga0496108_0137147 3300048911 Bacteria 2106
86 Ga0496109_0121590 3300048912 Bacteria 2432
87 Ga0496109_0601740 3300048912 Bacteria 1035
88 Ga0496112_0394809 3300048915 Bacteria 1323
89 Ga0496112_0431863 3300048915 Bacteria 1255
90 Ga0496115_0004222 3300048918 Bacteria 10386
91 Ga0496115_0100444 3300048918 Bacteria 2372
92 Ga0496117_0309239 3300048920 Bacteria 833
93 Ga0496118_0003621 3300048921 Bacteria 19177
94 Ga0496119_0212629 3300048922 Bacteria 994
95 Ga0496126_0014498 3300048929 Bacteria 7966
96 Ga0496126_0221657 3300048929 Bacteria 1588
97 Ga0501031_0131071 3300049568 Bacteria 1638
98 Ga0501036_0488897 3300049572 Bacteria 1024
99 Ga0501037_0082688 3300049573 Bacteria 2326
100 Ga0501037_0300397 3300049573 Bacteria 1115
101 Ga0501038_0033208 3300049574 Bacteria 4546
102 Ga0501040_0000785 3300049576 Bacteria 19752
103 Ga0501041_0001397 3300049577 Bacteria 13348
104 Ga0501043_0010421 3300049579 Bacteria 7283
105 Ga0501043_0125323 3300049579 Bacteria 2014
106 Ga0501043_0231612 3300049579 Bacteria 1427
107 Ga0501046_0013058 3300049580 Bacteria 7049
108 Ga0501046_0022648 3300049580 Bacteria 5175
109 Ga0501047_0005199 3300049581 Bacteria 12215
110 Ga0501047_0074457 3300049581 Bacteria 3269
111 Ga0501068_0041404 3300049584 Bacteria 2768
112 Ga0501070_0227892 3300049586 Bacteria 1527
113 Ga0501070_0278162 3300049586 Bacteria 1366
114 Ga0501071_0001412 3300049587 Bacteria 13811
115 Ga0501074_0147285 3300049590 Bacteria 1683
116 Ga0501075_0000989 3300049591 Bacteria 18118
117 Ga0501076_0002252 3300049592 Bacteria 13204
118 Ga0501077_0000767 3300049593 Bacteria 19373
119 Ga0501081_0019095 3300049743 Bacteria 4559
120 Ga0501035_0030402 3300049822 Bacteria 4923
121 Ga0501035_0131550 3300049822 Bacteria 2181
122 Ga0501035_0193425 3300049822 Bacteria 1748
123 Ga0501044_0000521 3300049823 Bacteria 46867
124 Ga0501044_0050024 3300049823 Bacteria 4314
125 Ga0501044_0213267 3300049823 Bacteria 1884
126 nmdc:mga05p37_153437_c1 3300050507 Bacteria 2816
127 nmdc:mga09592_196109_c1 3300050508 Bacteria 1748
128 nmdc:mga09592_447283_c1 3300050508 Bacteria 1115
129 nmdc:mga09592_48913_c1 3300050508 Bacteria 3565
130 nmdc:mga09592_796_c1 3300050508 Bacteria 24402
131 nmdc:mga0qj67_127575_c1 3300050509 Bacteria 2059
132 nmdc:mga0qj67_140981_c1 3300050509 Bacteria 1955
133 nmdc:mga0qj67_6216_c1 3300050509 Bacteria 8767
134 nmdc:mga06r32_151337_c1 3300050510 Bacteria 2299
135 nmdc:mga06r32_68889_c1 3300050510 Bacteria 3419
136 nmdc:mga06r32_810_c1 3300050510 Bacteria 27781
137 nmdc:mga08y16_19888_c1 3300050511 Bacteria 7082
138 Ga0500635_0000066 3300053080 Bacteria 69274
139 Ga0500559_0000173 3300053136 Bacteria 50992
140 Ga0500573_0016530 3300053140 Bacteria 4187
141 Ga0501084_0749796 3300054114 Bacteria 823
142 Ga0501082_0005574 3300060353 Bacteria 10934
143 Ga0530510_0000984 3300061734 Bacteria 18861
144 2587861990 2585428094 Bacteria 3604039
145 2644081538 2643221613 Bacteria 4622396
146 2644097396 2643221616 Bacteria 4066575
147 2644280153 2643221649 Bacteria 3867359
148 2644664820 2643221721 Bacteria 4486924
149 2729909108 2728369276 Bacteria 5610032
150 2731906284 2731639228 Bacteria 4187555
151 2739235688 2738543011 Bacteria 5731169
152 2753036520 2751185725 Bacteria 5740550
153 2753324390 2751185792 Bacteria 5739090
154 2799183273 2799112218 Bacteria 4315149
155 2812363182 2811994880 Bacteria 4147780
156 2855388495 2855386786 Bacteria 4752232
157 2884763400 2884763398 Bacteria 4091164
158 2887445238 2887443736 Bacteria 4426037
159 2935894571 2935890801 Bacteria 4593001
160 2939661987 2939660829 Bacteria 3784848
161 2964327881 2964326757 Bacteria 3290868
162 2966924464 2966921586 Bacteria 3092803
163 Ga0075428_100005703
164 CNXas_1000517
165 JGI24740J21852_10007366
166 JGI24743J22301_10019827
167 JGI24750J21931_1008957
168 JGI25162J39368_1007991
169 JGI25164J39214_1000299
170 JGI25406J46586_10000404
171 JGI25165J46597_1000005
172 Ga0070658_10000692
173 Ga0070658_10128976
174 Ga0070683_100298529
175 Ga0070680_100000823
176 Ga0070713_100010426
177 Ga0070678_100161744
178 Ga0070681_10001947
179 Ga0070679_100007867
180 Ga0070684_100067092
181 Ga0068855_100063072
182 Ga0070664_100059219
183 Ga0068864_100403615
184 Ga0081455_10025312
185 Ga0081540_1000517
186 Ga0075430_100002002
187 Ga0075430_100009368
188 Ga0075430_100049808
189 Ga0075430_100090450
190 Ga0075431_100000040
191 Ga0075431_100000972
192 Ga0075431_100092111
193 Ga0075431_100128657
194 Ga0075429_100000064
195 Ga0075429_100058159
196 Ga0105244_10027965
197 Ga0111539_10000426
198 Ga0114129_10013591
199 Ga0114129_10023131
200 Ga0114129_10096074
201 Ga0105243_10002105
202 Ga0105239_10283738
203 Ga0157369_10027609
204 Ga0157369_10083571
205 Ga0157369_10091792
206 Ga0157372_10041424
207 Ga0163163_10203823
208 Ga0163163_10332383
209 Ga0197907_10441761
210 Ga0197907_11294549
211 Ga0206356_10026423
212 Ga0206351_10905714
213 Ga0206352_10968830
214 Ga0206354_10114123
215 Ga0206354_11103434
216 Ga0206353_11444842
217 Ga0154015_1533751
218 Ga0224712_10055818
219 Ga0209563_100805
220 Ga0207427_100024
221 Ga0209437_100243
222 Ga0209233_1000001
223 Ga0207705_10028384
224 Ga0207707_10001001
225 Ga0207660_10000704
226 Ga0207657_10053322
227 Ga0207652_10001354
228 Ga0207681_10359949
229 Ga0207709_10006994
230 Ga0207669_10047212
231 Ga0207691_10011568
232 Ga0207667_10036126
233 Ga0207674_10040194
234 Ga0268264_10039416
235 Ga0265327_10000001
236 Ga0265327_10000471
237 Ga0395900_0002809
238 Ga0395898_0673113
239 Ga0400488_23359
240 Ga0451853_0175838
241 Ga0466970_0037048
242 Ga0466967_0012048
243 Ga0496102_0014042
244 Ga0496102_0146080
245 Ga0496104_0348368
246 Ga0496105_0277761
247 Ga0496108_0137147
248 Ga0496109_0121590
249 Ga0496109_0601740
250 Ga0496112_0394809
251 Ga0496112_0431863
252 Ga0496115_0004222
253 Ga0496115_0100444
254 Ga0496117_0309239
255 Ga0496118_0003621
256 Ga0496119_0212629
257 Ga0496126_0014498
258 Ga0496126_0221657
259 Ga0501031_0131071
260 Ga0501036_0488897
261 Ga0501037_0082688
262 Ga0501037_0300397
263 Ga0501038_0033208
264 Ga0501040_0000785
265 Ga0501041_0001397
266 Ga0501043_0010421
267 Ga0501043_0125323
268 Ga0501043_0231612
269 Ga0501046_0013058
270 Ga0501046_0022648
271 Ga0501047_0005199
272 Ga0501047_0074457
273 Ga0501068_0041404
274 Ga0501070_0227892
275 Ga0501070_0278162
276 Ga0501071_0001412
277 Ga0501074_0147285
278 Ga0501075_0000989
279 Ga0501076_0002252
280 Ga0501077_0000767
281 Ga0501081_0019095
282 Ga0501035_0030402
283 Ga0501035_0131550
284 Ga0501035_0193425
285 Ga0501044_0000521
286 Ga0501044_0050024
287 Ga0501044_0213267
288 nmdc:mga05p37_153437_c1
289 nmdc:mga09592_196109_c1
290 nmdc:mga09592_447283_c1
291 nmdc:mga09592_48913_c1
292 nmdc:mga09592_796_c1
293 nmdc:mga0qj67_127575_c1
294 nmdc:mga0qj67_140981_c1
295 nmdc:mga0qj67_6216_c1
296 nmdc:mga06r32_151337_c1
297 nmdc:mga06r32_68889_c1
298 nmdc:mga06r32_810_c1
299 nmdc:mga08y16_19888_c1
300 Ga0500635_0000066
301 Ga0500559_0000173
302 Ga0500573_0016530
303 Ga0501084_0749796
304 Ga0501082_0005574
305 Ga0530510_0000984
306 2587861990
307 2644081538
308 2644097396
309 2644280153
310 2644664820
311 2729909108
312 2731906284
313 2739235688
314 2753036520
315 2753324390
316 2799183273
317 2812363182
318 2855388495
319 2884763400
320 2887445238
321 2935894571
322 2939661987
323 2964327881
324 2966924464

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

2

145

0.94

PF00393

6PGD

6-phosphogluconate dehydrogenase, C-terminal domain

159

292

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wpu-assembly1.cif.gz_A structure of s-allyl-l-cysteine s-oxygenase from allium sativum 0.9375 2 30
3v3n-assembly3.cif.gz_C crystal structure of tetx2 t280a: an adaptive mutant in complex with minocycline 0.9358 2 30
3v3n-assembly4.cif.gz_D crystal structure of tetx2 t280a: an adaptive mutant in complex with minocycline 0.9353 2 30
3v3n-assembly1.cif.gz_A crystal structure of tetx2 t280a: an adaptive mutant in complex with minocycline 0.9349 2 30
3p9u-assembly4.cif.gz_D crystal structure of tetx2 from bacteroides thetaiotaomicron with substrate analogue 0.9331 2 30
ID Description Score Start End Superfamily
2w8zA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9447 2 163 3.40.50.720
af_A0A1D6E7M3_47_537_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9352 3 30 3.50.50.60
6fqxH01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9305 2 162 3.40.50.720
2y6qB00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.927 2 29 3.50.50.60
af_F4IAP5_318_484_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9166 2 143 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2S9GEU4-F1-model_v4 6-phosphogluconate dehydrogenase 1.005 83 166 GO:0004616
GO:0050661
AF-A0A7K0RNE6-F1-model_v4 deleted 0.9978 1 97
AF-A0A7K2P8W7-F1-model_v4 6-phosphogluconate dehydrogenase 0.9977 1 113 GO:0004616
GO:0050661
AF-A0A4Q5YXB7-F1-model_v4 deleted 0.9961 1 125
AF-A0A6I5CPF4-F1-model_v4 6-phosphogluconate dehydrogenase 0.9912 38 148 GO:0004616
GO:0050661

Map