F238341

General Info

Members Datasets Scaffolds Average Seq Length
162 122 123 417

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10104348|Ga0065704_101043482
Length 437
Sequence MYPVGDFPNSTFAALNKSDMTIDFEKASFKDFEDIAGIDPFGRASLFNDYSIYKRERGQMNYRQLAISGCGPEITLKIPGIPINRFVSLVSNDYLGFTQHPEVKAAAIAAIEKYGSGVGASPAIGGHMDFHEALEQKIAGFFQRESAIIYTTGYTSNSATLQCLLRKSDLAILDQAVHASVYEGCQLSNVKSFPHNNLHALERILAASQTKYRTRMVIVDGVYSQDGDLAPLKEIVELCKRYGAYSVVDDAHGTGVIGKTGRGVIELNDLFQEVDLITGTFSKTFAHIGGYVVARPELINFLKFQSRQHLFSASSTPAAACILKAIDLVDQEPHWMDQLREKTEYLRSGLRNLGLNTGISQSAIIPVKIGDITRNAEVCRLLLEAGVYANQINYPAVSRKDARIRMSVMATHSYEHLDEVLNAWEWVVTKSKIVNFE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
3 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
4 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
5 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
6 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
7 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
8 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
9 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
10 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
11 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
12 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
13 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
14 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
15 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
16 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
17 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
18 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
19 2738543023 Pedobacter sp. OK628 Isolate Unclassified
20 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
21 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
22 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
23 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
24 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
25 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
26 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
27 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
28 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
29 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
30 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
31 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
32 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
33 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
34 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
35 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
36 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
37 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
38 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
39 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
40 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
41 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
42 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
43 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
44 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
45 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
46 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
47 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
48 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
49 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
50 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
51 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
72 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
73 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
74 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
75 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
85 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
86 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
95 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
96 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
97 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
98 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
99 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
100 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
101 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
102 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
103 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
104 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
105 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
106 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
107 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
108 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
109 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
110 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
111 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
112 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
113 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
114 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
115 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
116 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
117 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
118 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
119 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
120 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
121 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
122 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.69
Metatranscriptomes 0.62
Isolates 24.69

Biome Distribution

Category Percentage (%)
Aerial Root 1.23
Bulb 0
Endosphere 3.09
Nodule 0.62
Rhizoplane 1.23
Rhizosphere 70.37
Stem 0
Stem Tuber 0
Unclassified 23.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3327501 2162886007 Bacteria 1128
2 JGI24739J22299_10003521 3300001989 Bacteria 5979
3 JGI24735J21928_10000005 3300002067 Bacteria 356755
4 JGI25162J39368_1000005 3300002737 Bacteria 435925
5 rootH1_10172485 3300003316 Bacteria 3341
6 rootH2_10001891 3300003320 Bacteria 464318
7 rootH2_10024944 3300003320 Bacteria 5261
8 rootH2_10119194 3300003320 Bacteria 8380
9 rootL2_10119766 3300003322 Bacteria 3696
10 rootL2_10158102 3300003322 Bacteria 9744
11 rootL2_10285716 3300003322 Bacteria 2319
12 rootH1_10000566 3300003316 Bacteria 33162
13 rootH1_10000566 3300003323 Bacteria 205679
14 rootH1_10069386 3300003316 Bacteria 2877
15 rootH1_10069386 3300003323 Bacteria 8097
16 rootH1_10114741 3300003323 Bacteria 6362
17 rootH1_10236592 3300003323 Viruses 2046
18 Ga0006562J51391_1002321 3300003578 Bacteria 2482
19 Ga0065714_10064593 3300005288 Bacteria 30901
20 Ga0065714_10092670 3300005288 Bacteria 1868
21 Ga0065704_10073437 3300005289 Bacteria 7162
22 Ga0065704_10074942 3300005289 Bacteria 5870
23 Ga0065704_10104348 3300005289 Unclassified 2144
24 Ga0068855_100000222 3300005563 Bacteria 72681
25 Ga0068856_100000005 3300005614 Bacteria 225505
26 Ga0068856_100000021 3300005614 Bacteria 145017
27 Ga0097621_100000235 3300006237 Bacteria 37163
28 Ga0068871_100013030 3300006358 Bacteria 6162
29 Ga0105244_10000080 3300009036 Bacteria 106764
30 Ga0105240_10000221 3300009093 Bacteria 114656
31 Ga0105243_10000007 3300009148 Bacteria 445042
32 Ga0105248_10288752 3300009177 Bacteria 1847
33 Ga0105237_10000693 3300009545 Bacteria 46571
34 Ga0105237_10289550 3300009545 Unclassified 1641
35 Ga0105238_10016851 3300009551 Bacteria 7412
36 Ga0105239_10000005 3300010375 Bacteria 496066
37 Ga0105239_10000053 3300010375 Bacteria 163705
38 Ga0105239_10000738 3300010375 Bacteria 46490
39 Ga0157373_10000048 3300013100 Bacteria 110104
40 Ga0157373_10000053 3300013100 Bacteria 104200
41 Ga0157371_10042207 3300013102 Unclassified 3251
42 Ga0157370_10000205 3300013104 Bacteria 74877
43 Ga0157370_10029150 3300013104 Bacteria 5421
44 Ga0157369_10111416 3300013105 Bacteria 2908
45 Ga0163162_10015333 3300013306 Bacteria 7488
46 Ga0163162_10085161 3300013306 Bacteria 3237
47 Ga0157372_10000326 3300013307 Bacteria 52158
48 Ga0157375_10003611 3300013308 Bacteria 13422
49 Ga0182008_10000030 3300014497 Bacteria 169168
50 Ga0182008_10002274 3300014497 Bacteria 12124
51 Ga0182006_1000011 3300015261 Bacteria 408647
52 Ga0182007_10000023 3300015262 Bacteria 187131
53 Ga0209437_100043 3300025233 Bacteria 440454
54 Ga0209026_1000238 3300025250 Bacteria 71772
55 Ga0209675_1000056 3300025291 Bacteria 187664
56 Ga0207655_1001862 3300025728 Bacteria 18200
57 Ga0207695_10000189 3300025913 Bacteria 177142
58 Ga0207671_10000624 3300025914 Bacteria 46503
59 Ga0207671_10150736 3300025914 Bacteria 1796
60 Ga0207694_10000244 3300025924 Bacteria 52258
61 Ga0207709_10000033 3300025935 Bacteria 320483
62 Ga0207711_10196114 3300025941 Bacteria 1842
63 Ga0207667_10028222 3300025949 Bacteria 6098
64 Ga0207702_10000047 3300026078 Bacteria 143192
65 Ga0207702_10000515 3300026078 Bacteria 43571
66 Ga0307515_10179158 3300028794 Bacteria 2077
67 Ga0265338_10000563 3300028800 Bacteria 65172
68 Ga0307407_10000040 3300031903 Bacteria 66966
69 Ga0307412_10000012 3300031911 Bacteria 404180
70 Ga0307412_10000063 3300031911 Bacteria 125959
71 Ga0307412_10001689 3300031911 Bacteria 12204
72 Ga0307412_10003616 3300031911 Bacteria 8590
73 Ga0307416_100000033 3300032002 Bacteria 156736
74 Ga0307414_10000923 3300032004 Bacteria 15036
75 Ga0307414_10027540 3300032004 Bacteria 3675
76 Ga0307414_10043630 3300032004 Bacteria 3056
77 Ga0307414_10091138 3300032004 Bacteria 2265
78 Ga0395899_0000001 3300037312 Bacteria 1750322
79 Ga0395899_0000027 3300037312 Bacteria 337387
80 Ga0395900_0111506 3300037418 Bacteria 2810
81 Ga0395905_0000769 3300037471 Bacteria 42306
82 Ga0395901_0002005 3300038443 Bacteria 20948
83 Ga0439465_0006798 3300041413 Bacteria 3635
84 Ga0439445_0000767 3300042004 Bacteria 6741
85 Ga0495627_000003 3300046453 Bacteria 704557
86 Ga0495627_016389 3300046453 Bacteria 2537
87 Ga0495596_0003715 3300046500 Bacteria 7627
88 Ga0495606_0016900 3300046507 Bacteria 5540
89 Ga0495610_0000001 3300046512 Bacteria 1620061
90 Ga0495632_0003666 3300046519 Bacteria 10774
91 Ga0495643_0013277 3300046522 Bacteria 4935
92 Ga0495654_0000001 3300046530 Bacteria 1513197
93 Ga0495633_0000007 3300046558 Bacteria 317976
94 Ga0495625_0001118 3300046660 Bacteria 34697
95 Ga0495625_0001255 3300046660 Bacteria 32025
96 Ga0495625_0007526 3300046660 Bacteria 9460
97 Ga0495661_0052751 3300046665 Bacteria 2448
98 Ga0495686_0000398 3300047472 Bacteria 68969
99 Ga0495686_0009612 3300047472 Bacteria 6946
100 Ga0495686_0015609 3300047472 Bacteria 5181
101 Ga0496102_0159622 3300048905 Bacteria 2120
102 Ga0496115_0018248 3300048918 Bacteria 5383
103 Ga0496116_0000012 3300048919 Bacteria 611365
104 Ga0496117_0000257 3300048920 Bacteria 99879
105 Ga0496118_0000196 3300048921 Bacteria 106933
106 Ga0496119_0000002 3300048922 Bacteria 738385
107 Ga0496121_0112467 3300048924 Bacteria 2074
108 Ga0496122_0000633 3300048925 Bacteria 71586
109 Ga0496122_0000848 3300048925 Bacteria 57604
110 Ga0496122_0000950 3300048925 Bacteria 52444
111 Ga0496122_0003496 3300048925 Bacteria 20642
112 Ga0496122_0011585 3300048925 Bacteria 8901
113 Ga0496124_0022799 3300048927 Bacteria 5732
114 Ga0496125_0000878 3300048928 Bacteria 47703
115 Ga0496125_0008111 3300048928 Bacteria 11061
116 Ga0496125_0025850 3300048928 Bacteria 5365
117 Ga0496126_0000114 3300048929 Bacteria 188605
118 Ga0501251_001753 3300049681 Bacteria 2040
119 Ga0501241_000005 3300049758 Bacteria 176449
120 Ga0501241_010921 3300049758 Unclassified 1650
121 Ga0501269_000012 3300049766 Bacteria 61214
122 Ga0500608_032961 3300053122 Bacteria 2464
123 Ga0500618_000472 3300053125 Bacteria 26098

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003323 rootH1_10069386 rootH1_100693862 326
2 3300025924 Ga0207694_10000244 Ga0207694_1000024451 331
3 iso_pu_bacteria 2896344016 2896346738 341
4 3300003578 Ga0006562J51391_1002321 Ga0006562J51391_10023211 343
5 3300003320 rootH2_10024944 rootH2_100249444 344
6 3300005614 Ga0068856_100000005 Ga0068856_10000000541 344
7 3300005614 Ga0068856_100000021 Ga0068856_100000021113 344
8 3300009093 Ga0105240_10000221 Ga0105240_1000022174 344
9 3300009545 Ga0105237_10289550 Ga0105237_102895503 344
10 3300009551 Ga0105238_10016851 Ga0105238_100168516 344
11 3300010375 Ga0105239_10000005 Ga0105239_10000005292 344
12 3300010375 Ga0105239_10000053 Ga0105239_10000053114 344
13 3300010375 Ga0105239_10000738 Ga0105239_1000073835 344
14 3300025913 Ga0207695_10000189 Ga0207695_1000018937 344
15 3300026078 Ga0207702_10000047 Ga0207702_1000004744 344
16 3300026078 Ga0207702_10000515 Ga0207702_1000051532 344
17 3300031903 Ga0307407_10000040 Ga0307407_1000004024 344
18 3300037312 Ga0395899_0000001 Ga0395899_0000001_1149278_1150507 344
19 3300037418 Ga0395900_0111506 Ga0395900_0111506_682_1908 344
20 3300037471 Ga0395905_0000769 Ga0395905_0000769_40550_41779 344
21 3300038443 Ga0395901_0002005 Ga0395901_0002005_17167_18396 344
22 iso_pu_bacteria 2585427687 2586210537 344
23 3300009177 Ga0105248_10288752 Ga0105248_102887522 345
24 3300025941 Ga0207711_10196114 Ga0207711_101961142 345
25 3300028800 Ga0265338_10000563 Ga0265338_1000056322 345
26 3300003322 rootL2_10158102 rootL2_101581023 346
27 3300013104 Ga0157370_10000205 Ga0157370_1000020561 346
28 3300014497 Ga0182008_10002274 Ga0182008_100022743 346
29 iso_pu_bacteria 3003233435 3003234189 346
30 3300003322 rootL2_10285716 rootL2_102857162 347
31 3300005288 Ga0065714_10064593 Ga0065714_1006459313 347
32 3300048918 Ga0496115_0018248 Ga0496115_0018248_3713_4969 347
33 3300001989 JGI24739J22299_10003521 JGI24739J22299_100035218 348
34 3300002067 JGI24735J21928_10000005 JGI24735J21928_10000005280 348
35 3300003316 rootH1_10172485 rootH1_101724853 348
36 3300003320 rootH2_10001891 rootH2_10001891293 348
37 3300003323 rootH1_10000566 rootH1_10000566115 348
38 3300003323 rootH1_10236592 rootH1_102365922 348
39 3300005288 Ga0065714_10092670 Ga0065714_100926702 348
40 3300005289 Ga0065704_10073437 Ga0065704_100734371 348
41 3300005289 Ga0065704_10104348 Ga0065704_101043482 348
42 3300005563 Ga0068855_100000222 Ga0068855_10000022246 348
43 3300006237 Ga0097621_100000235 Ga0097621_10000023518 348
44 3300006358 Ga0068871_100013030 Ga0068871_1000130306 348
45 3300009545 Ga0105237_10000693 Ga0105237_100006938 348
46 3300013100 Ga0157373_10000048 Ga0157373_1000004817 348
47 3300013100 Ga0157373_10000053 Ga0157373_1000005370 348
48 3300013102 Ga0157371_10042207 Ga0157371_100422072 348
49 3300013306 Ga0163162_10085161 Ga0163162_100851614 348
50 3300013307 Ga0157372_10000326 Ga0157372_1000032615 348
51 3300014497 Ga0182008_10000030 Ga0182008_1000003079 348
52 3300015262 Ga0182007_10000023 Ga0182007_1000002353 348
53 3300025250 Ga0209026_1000238 Ga0209026_100023848 348
54 3300025914 Ga0207671_10000624 Ga0207671_100006248 348
55 3300025949 Ga0207667_10028222 Ga0207667_100282228 348
56 3300028794 Ga0307515_10179158 Ga0307515_101791582 348
57 3300031911 Ga0307412_10000063 Ga0307412_1000006389 348
58 3300032004 Ga0307414_10000923 Ga0307414_100009233 348
59 3300032004 Ga0307414_10043630 Ga0307414_100436302 348
60 3300032004 Ga0307414_10091138 Ga0307414_100911382 348
61 3300037312 Ga0395899_0000027 Ga0395899_0000027_310101_311366 348
62 3300046660 Ga0495625_0001118 Ga0495625_0001118_19887_21167 348
63 3300049758 Ga0501241_010921 Ga0501241_010921_328_1587 348
64 3300053122 Ga0500608_032961 Ga0500608_032961_719_1981 348
65 iso_pu_bacteria 2738543023 2739303665 348
66 iso_pu_bacteria 2852623160 2852625897 348
67 3300002737 JGI25162J39368_1000005 JGI25162J39368_100000527 349
68 3300003320 rootH2_10119194 rootH2_101191947 349
69 3300003322 rootL2_10119766 rootL2_101197661 349
70 3300003323 rootH1_10114741 rootH1_101147417 349
71 3300009036 Ga0105244_10000080 Ga0105244_1000008018 349
72 3300013104 Ga0157370_10029150 Ga0157370_100291505 349
73 3300013105 Ga0157369_10111416 Ga0157369_101114161 349
74 3300013308 Ga0157375_10003611 Ga0157375_100036116 349
75 3300015261 Ga0182006_1000011 Ga0182006_100001148 349
76 3300025233 Ga0209437_100043 Ga0209437_100043370 349
77 3300025291 Ga0209675_1000056 Ga0209675_1000056147 349
78 3300025728 Ga0207655_1001862 Ga0207655_100186218 349
79 3300025914 Ga0207671_10150736 Ga0207671_101507361 349
80 3300031911 Ga0307412_10000012 Ga0307412_10000012406 349
81 3300031911 Ga0307412_10001689 Ga0307412_100016896 349
82 3300031911 Ga0307412_10003616 Ga0307412_100036168 349
83 3300032002 Ga0307416_100000033 Ga0307416_10000003391 349
84 3300032004 Ga0307414_10027540 Ga0307414_100275402 349
85 3300037312 Ga0395899_0000001 Ga0395899_0000001_228353_229624 349
86 3300041413 Ga0439465_0006798 Ga0439465_0006798_580_1833 349
87 3300042004 Ga0439445_0000767 Ga0439445_0000767_536_1792 349
88 3300046453 Ga0495627_000003 Ga0495627_000003_631916_633172 349
89 3300046453 Ga0495627_016389 Ga0495627_016389_201_1460 349
90 3300046500 Ga0495596_0003715 Ga0495596_0003715_5198_6454 349
91 3300046512 Ga0495610_0000001 Ga0495610_0000001_1246758_1248014 349
92 3300046519 Ga0495632_0003666 Ga0495632_0003666_7355_8614 349
93 3300046522 Ga0495643_0013277 Ga0495643_0013277_1602_2861 349
94 3300046530 Ga0495654_0000001 Ga0495654_0000001_507067_508323 349
95 3300046558 Ga0495633_0000007 Ga0495633_0000007_64403_65659 349
96 3300046660 Ga0495625_0007526 Ga0495625_0007526_6194_7453 349
97 3300046665 Ga0495661_0052751 Ga0495661_0052751_227_1528 349
98 3300047472 Ga0495686_0000398 Ga0495686_0000398_54367_55626 349
99 3300047472 Ga0495686_0009612 Ga0495686_0009612_5645_6901 349
100 3300047472 Ga0495686_0015609 Ga0495686_0015609_1617_2888 349
101 3300048905 Ga0496102_0159622 Ga0496102_0159622_336_1592 349
102 3300048919 Ga0496116_0000012 Ga0496116_0000012_151143_152399 349
103 3300048920 Ga0496117_0000257 Ga0496117_0000257_67748_69004 349
104 3300048921 Ga0496118_0000196 Ga0496118_0000196_65586_66842 349
105 3300048922 Ga0496119_0000002 Ga0496119_0000002_325885_327141 349
106 3300048924 Ga0496121_0112467 Ga0496121_0112467_191_1447 349
107 3300048925 Ga0496122_0000633 Ga0496122_0000633_2693_3949 349
108 3300048925 Ga0496122_0000848 Ga0496122_0000848_50680_51936 349
109 3300048925 Ga0496122_0000950 Ga0496122_0000950_14594_15850 349
110 3300048925 Ga0496122_0003496 Ga0496122_0003496_5663_6919 349
111 3300048925 Ga0496122_0011585 Ga0496122_0011585_4954_6210 349
112 3300048927 Ga0496124_0022799 Ga0496124_0022799_1054_2310 349
113 3300048928 Ga0496125_0000878 Ga0496125_0000878_5687_6943 349
114 3300048928 Ga0496125_0008111 Ga0496125_0008111_2693_3949 349
115 3300048928 Ga0496125_0025850 Ga0496125_0025850_3869_5125 349
116 3300048929 Ga0496126_0000114 Ga0496126_0000114_151160_152416 349
117 3300049681 Ga0501251_001753 Ga0501251_001753_514_1767 349
118 3300049758 Ga0501241_000005 Ga0501241_000005_13922_15175 349
119 3300049766 Ga0501269_000012 Ga0501269_000012_12351_13604 349
120 3300053125 Ga0500618_000472 Ga0500618_000472_17989_19290 349
121 iso_pu_bacteria 2511231000 2511234162 349
122 iso_pu_bacteria 2582581278 2585142662 349
123 iso_pu_bacteria 2582581281 2585156936 349
124 iso_pu_bacteria 2582581282 2585161169 349
125 iso_pu_bacteria 2585428045 2587678463 349
126 iso_pu_bacteria 2585428060 2587750167 349
127 iso_pu_bacteria 2585428115 2587943139 349
128 iso_pu_bacteria 2585428182 2588208569 349
129 iso_pu_bacteria 2585428183 2588212938 349
130 iso_pu_bacteria 2585428184 2588219528 349
131 iso_pu_bacteria 2585428185 2588224161 349
132 iso_pu_bacteria 2585428187 2588233674 349
133 iso_pu_bacteria 2588253712 2588446209 349
134 iso_pu_bacteria 2588254255 2590600502 349
135 iso_pu_bacteria 2588254257 2590611751 349
136 iso_pu_bacteria 2728369107 2729201731 349
137 iso_pu_bacteria 2739367874 2740057395 349
138 iso_pu_bacteria 2751185877 2753672920 349
139 iso_pu_bacteria 2765235839 2765572308 349
140 iso_pu_bacteria 2775506739 2775673090 349
141 iso_pu_bacteria 2816332188 2816872583 349
142 iso_pu_bacteria 2842083920 2842083990 349
143 iso_pu_bacteria 2871720351 2871722919 349
144 iso_pu_bacteria 2889290771 2889292056 349
145 iso_pu_bacteria 2905999023 2906003022 349
146 iso_pu_bacteria 2919097161 2919097175 349
147 iso_pu_bacteria 2919399522 2919402692 349
148 iso_pu_bacteria 2945924605 2945927532 349
149 iso_pu_bacteria 2946019816 2946021185 349
150 iso_pu_bacteria 2993372514 2993373612 349
151 iso_pu_bacteria 2993480792 2993484285 349
152 2162886007 SwRhRL2b_contig_3327501 SwRhRL2b_0657.00003240 350
153 3300005289 Ga0065704_10074942 Ga0065704_100749422 350
154 3300009148 Ga0105243_10000007 Ga0105243_10000007172 350
155 3300013306 Ga0163162_10015333 Ga0163162_100153333 350
156 3300025935 Ga0207709_10000033 Ga0207709_10000033272 350
157 3300046507 Ga0495606_0016900 Ga0495606_0016900_1053_2312 350
158 3300046660 Ga0495625_0001255 Ga0495625_0001255_16132_17421 350
159 iso_pu_bacteria 2772190705 2772605155 350
160 iso_pu_bacteria 2977243572 2977246347 350
161 iso_pu_bacteria 2984572630 2984575743 350
162 iso_pu_bacteria 2984606641 2984609198 350

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

84

423

0.92

PF00266

Aminotran_5

Aminotransferase class-V

93

258

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bxp-assembly1.cif.gz_B 2-amino-3-ketobutyrate coa ligase from cupriavidus necator 0.9573 2 346
4bmk-assembly1.cif.gz_A serine palmitoyltransferase k265a from s. paucimobilis with bound plp- myriocin aldimine 0.9566 2 346
8guh-assembly1.cif.gz_A serine palmitoyltransferase from sphingobacterium multivorum complexed with tris 0.9545 2 342
7v5i-assembly1.cif.gz_B structural insights into the substrate selectivity of acyl-coa transferase 0.9539 2 342
1fc4-assembly1.cif.gz_B 2-amino-3-ketobutyrate coa ligase 0.953 2 345
ID Description Score Start End Superfamily
af_I1JW06_395_456_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9757 275 335 3.90.1150.10
af_Q2G0M8_295_394_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9749 248 342 3.90.1150.10
3a2bA01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9686 250 342 3.90.1150.10
af_Q4CT40_69_162_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9639 250 336 3.90.1150.10
af_O94069_405_493_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9595 249 333 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A292PHR7-F1-model_v4 HTH tetR-type domain-containing protein 0.9827 1 350 GO:0003677
GO:0009058
GO:0030170
AF-A0A401LZ32-F1-model_v4 Aminotransferase class I/classII large domain-containing protein 0.9818 115 346 GO:0009058
GO:0016740
GO:0030170
AF-A0A3D2WWS6-F1-model_v4 8-amino-7-oxononanoate synthase 0.9816 245 346 GO:0009058
GO:0030170
AF-A0A381TWV1-F1-model_v4 Aminotransferase class I/classII large domain-containing protein 0.9789 256 342 GO:0009058
GO:0030170
AF-A0A069SC15-F1-model_v4 deleted 0.9776 1 246

Feature Viewer

pLDDT pTM Quality
92.92 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map