F237690

General Info

Members Datasets Scaffolds Average Seq Length
161 103 322 194

Family's Representative Sequence

Representative Sequence 3300046516|Ga0495628_0145045|Ga0495628_0145045_714_1379
Length 221
Sequence MENFFSSCSAIHYLSSWGDLTMPTRNDAWKLLCEYTQSESLRKHMLAVETCVRAYARKNNADEDIWGLAALLHDFDYERWPNNGHAADKEHPAEGARILKDLGYSDEITRAILSHADYSGVARQSALEHTLFACDELAGFLTACTYVRPSKSILDLEADSVKKRMKDKAFARGVSRDDVRKGAEELGVPLEEHVAFCIKAMRENADALGLRGNIASQSAAS

Samples

Sample ID Description Type Environment
1 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
2 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
3 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
22 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
23 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
24 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
25 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
42 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
44 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
45 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
46 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
48 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
66 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
67 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
68 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
69 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
70 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
71 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
72 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
73 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
74 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
75 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
76 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
77 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
78 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
79 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
80 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
81 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
82 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
83 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
84 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
85 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
86 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
87 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
88 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
89 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
90 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
91 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
92 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
93 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
94 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
95 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
98 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
99 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
101 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
102 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
103 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.65
Metatranscriptomes 4.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.35
Rhizosphere 78.26
Stem 0
Stem Tuber 0
Unclassified 18.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495628_0145045 3300046516 Bacteria 1810
2 Ga0070687_100235925 3300005343 Bacteria 1128
3 Ga0070673_100505767 3300005364 Unclassified 1093
4 Ga0070714_100070554 3300005435 Bacteria 3020
5 Ga0070714_100687059 3300005435 Unclassified 987
6 Ga0070713_100257433 3300005436 Bacteria 1594
7 Ga0070713_100529550 3300005436 Bacteria 1114
8 Ga0070710_10328337 3300005437 Bacteria 1006
9 Ga0070711_100017837 3300005439 Bacteria 4524
10 Ga0070705_100300538 3300005440 Bacteria 1150
11 Ga0070708_100435985 3300005445 Bacteria 1236
12 Ga0070663_100042131 3300005455 Unclassified 3207
13 Ga0070681_10032098 3300005458 Bacteria 5270
14 Ga0070706_100797808 3300005467 Bacteria 874
15 Ga0070698_100171686 3300005471 Unclassified 2109
16 Ga0070679_100057743 3300005530 Bacteria 3868
17 Ga0070704_100010533 3300005549 Bacteria 5629
18 Ga0068855_100404226 3300005563 Unclassified 1496
19 Ga0068855_100465358 3300005563 Archaea 1378
20 Ga0068856_100063094 3300005614 Bacteria 3660
21 Ga0068863_100432616 3300005841 Bacteria 1290
22 Ga0068860_100013375 3300005843 Bacteria 8045
23 Ga0081455_10056587 3300005937 Bacteria 3328
24 Ga0070716_100003737 3300006173 Bacteria 7206
25 Ga0070716_100016937 3300006173 Unclassified 3771
26 Ga0070712_100247798 3300006175 Bacteria 1422
27 Ga0075436_100012878 3300006914 Bacteria 5734
28 Ga0075436_100043038 3300006914 Unclassified 3113
29 Ga0099794_10012705 3300007265 Bacteria 3643
30 Ga0099794_10018067 3300007265 Bacteria 3156
31 Ga0099794_10040399 3300007265 Bacteria 2218
32 Ga0099794_10047794 3300007265 Bacteria 2052
33 Ga0099794_10061408 3300007265 Bacteria 1826
34 Ga0099794_10214004 3300007265 Bacteria 989
35 Ga0099794_10233935 3300007265 Unclassified 946
36 Ga0099795_10073305 3300007788 Unclassified 1296
37 Ga0105240_10913399 3300009093 Unclassified 944
38 Ga0105245_10200363 3300009098 Bacteria 1917
39 Ga0114129_10187673 3300009147 Bacteria 2809
40 Ga0105242_10188227 3300009176 Bacteria 1826
41 Ga0105248_10084477 3300009177 Unclassified 3571
42 Ga0105237_10216722 3300009545 Archaea 1914
43 Ga0099796_10020897 3300010159 Bacteria 2008
44 Ga0105239_10103737 3300010375 Bacteria 3148
45 Ga0157370_10089487 3300013104 Bacteria 2891
46 Ga0157370_10610130 3300013104 Unclassified 999
47 Ga0157370_10965120 3300013104 Unclassified 772
48 Ga0157369_10058849 3300013105 Bacteria 4144
49 Ga0157369_10347184 3300013105 Bacteria 1541
50 Ga0157369_10505635 3300013105 Bacteria 1250
51 Ga0157369_10618091 3300013105 Archaea 1118
52 Ga0157374_10008495 3300013296 Bacteria 8784
53 Ga0157372_10511003 3300013307 Bacteria 1401
54 Ga0157372_10879276 3300013307 Bacteria 1040
55 Ga0157375_10646785 3300013308 Bacteria 1214
56 Ga0197907_10160857 3300020069 Bacteria 1713
57 Ga0206349_1684059 3300020075 Bacteria 1138
58 Ga0206355_1705521 3300020076 Unclassified 1584
59 Ga0206351_10382910 3300020077 Bacteria 1088
60 Ga0213872_10001502 3300021361 Bacteria 15026
61 Ga0213876_10010031 3300021384 Bacteria 5090
62 Ga0213876_10023998 3300021384 Unclassified 3220
63 Ga0213875_10000017 3300021388 Bacteria 239813
64 Ga0213875_10021749 3300021388 Bacteria 3069
65 Ga0213875_10026073 3300021388 Bacteria 2783
66 Ga0213875_10039995 3300021388 Unclassified 2208
67 Ga0213875_10060006 3300021388 Bacteria 1779
68 Ga0224712_10038055 3300022467 Bacteria 1795
69 Ga0224712_10050095 3300022467 Bacteria 1621
70 Ga0224712_10088753 3300022467 Unclassified 1291
71 Ga0224572_1004228 3300024225 Bacteria 2484
72 Ga0207692_10510840 3300025898 Bacteria 764
73 Ga0207699_10070963 3300025906 Bacteria 2128
74 Ga0207684_10486804 3300025910 Bacteria 1058
75 Ga0207707_10252007 3300025912 Archaea 1533
76 Ga0207695_10137040 3300025913 Unclassified 2400
77 Ga0207671_10569601 3300025914 Unclassified 903
78 Ga0207652_10243115 3300025921 Bacteria 1623
79 Ga0207700_10107043 3300025928 Bacteria 2243
80 Ga0207706_10911298 3300025933 Unclassified 742
81 Ga0207686_10222996 3300025934 Bacteria 1362
82 Ga0207665_10000031 3300025939 Bacteria 91884
83 Ga0207665_10035514 3300025939 Unclassified 3309
84 Ga0207665_10579661 3300025939 Bacteria 874
85 Ga0207661_10090061 3300025944 Bacteria 2554
86 Ga0207678_10199391 3300026067 Unclassified 1711
87 Ga0207702_10022078 3300026078 Bacteria 5273
88 Ga0207641_10318995 3300026088 Bacteria 1473
89 Ga0209588_1030247 3300027671 Bacteria 1729
90 Ga0209588_1053715 3300027671 Unclassified 1303
91 Ga0209588_1084612 3300027671 Bacteria 1024
92 Ga0209588_1102259 3300027671 Bacteria 922
93 Ga0268264_10020337 3300028381 Bacteria 5425
94 Ga0265338_10020135 3300028800 Bacteria 7034
95 Ga0373943_0049024 3300035170 Archaea 2071
96 Ga0373955_0246370 3300035172 Archaea 1071
97 Ga0373935_0446159 3300035692 Archaea 934
98 Ga0373927_0093105 3300035695 Bacteria 1958
99 Ga0373947_0139961 3300035725 Archaea 1551
100 Ga0395900_0617662 3300037418 Bacteria 1023
101 Ga0395898_0322590 3300037466 Bacteria 1473
102 Ga0436364_0026588 3300037853 Bacteria 13261
103 Ga0436364_0031339 3300037853 Unclassified 3874
104 Ga0436364_0074081 3300037853 Bacteria 1002
105 Ga0436364_0339530 3300037853 Bacteria 240640
106 Ga0436364_0373060 3300037853 Bacteria 11289
107 Ga0436364_0663079 3300037853 Unclassified 746
108 Ga0436364_0679077 3300037853 Bacteria 2336
109 Ga0436364_0735144 3300037853 Bacteria 6099
110 Ga0436364_0770585 3300037853 Bacteria 2827
111 Ga0436364_1031181 3300037853 Unclassified 1696
112 Ga0436364_1160939 3300037853 Unclassified 777
113 Ga0436364_1171574 3300037853 Unclassified 690
114 Ga0436364_1198992 3300037853 Unclassified 651
115 Ga0436364_1552384 3300037853 Bacteria 5289
116 Ga0436364_1560898 3300037853 Unclassified 664
117 Ga0436365_0027270 3300039437 Bacteria 19731
118 Ga0436365_0801212 3300039437 Bacteria 1279
119 Ga0436365_0927493 3300039437 Bacteria 1454
120 Ga0436365_1067054 3300039437 Bacteria 4915
121 Ga0436365_1122548 3300039437 Bacteria 4296
122 Ga0436360_0626405 3300039438 Bacteria 1087
123 Ga0436360_1140368 3300039438 Bacteria 1641
124 Ga0436361_0761235 3300039447 Bacteria 90297
125 Ga0436363_0317412 3300039450 Bacteria 1389
126 Ga0436362_0090188 3300039453 Bacteria 1674
127 Ga0436362_0827255 3300039453 Bacteria 1870
128 Ga0466968_0145919 3300044735 Bacteria 1085
129 Ga0495580_0178144 3300046472 Bacteria 1468
130 Ga0495580_0632634 3300046472 Bacteria 705
131 Ga0495582_0113650 3300046473 Archaea 1522
132 Ga0495594_0126731 3300046499 Archaea 1445
133 Ga0495586_0291888 3300046535 Archaea 934
134 Ga0495645_0188105 3300046543 Bacteria 1409
135 Ga0495658_0054683 3300046683 Archaea 2272
136 Ga0495581_0152280 3300047315 Bacteria 1351
137 Ga0495680_0429168 3300047322 Archaea 908
138 Ga0495684_0236571 3300047471 Bacteria 1334
139 Ga0496100_0394351 3300048903 Bacteria 1053
140 Ga0496102_0007799 3300048905 Bacteria 9151
141 Ga0496103_0165216 3300048906 Bacteria 1420
142 Ga0496105_0042513 3300048908 Bacteria 3746
143 Ga0496108_0175178 3300048911 Bacteria 1857
144 Ga0496112_0038563 3300048915 Bacteria 4666
145 Ga0496112_0458578 3300048915 Bacteria 1212
146 Ga0501046_0236180 3300049580 Bacteria 1349
147 Ga0501047_0004180 3300049581 Bacteria 13587
148 Ga0501047_0029783 3300049581 Bacteria 5261
149 Ga0501047_0165055 3300049581 Bacteria 2085
150 Ga0501070_0036629 3300049586 Bacteria 4097
151 Ga0501073_0476269 3300049589 Bacteria 863
152 Ga0501035_0010694 3300049822 Bacteria 8495
153 Ga0501035_0221741 3300049822 Bacteria 1614
154 Ga0501044_0000165 3300049823 Bacteria 82268
155 Ga0501044_0000665 3300049823 Bacteria 41466
156 Ga0501044_0295230 3300049823 Bacteria 1551
157 nmdc:mga05p37_155853_c1 3300050507 Bacteria 2791
158 nmdc:mga08x19_15049_c2 3300050514 Bacteria 2600
159 nmdc:mga08x19_178539_c1 3300050514 Bacteria 1449
160 nmdc:mga08x19_730133_c1 3300050514 Bacteria 703
161 Ga0495612_0048767 3300053078 Bacteria 1736
162 Ga0495628_0145045
163 Ga0070687_100235925
164 Ga0070673_100505767
165 Ga0070714_100070554
166 Ga0070714_100687059
167 Ga0070713_100257433
168 Ga0070713_100529550
169 Ga0070710_10328337
170 Ga0070711_100017837
171 Ga0070705_100300538
172 Ga0070708_100435985
173 Ga0070663_100042131
174 Ga0070681_10032098
175 Ga0070706_100797808
176 Ga0070698_100171686
177 Ga0070679_100057743
178 Ga0070704_100010533
179 Ga0068855_100404226
180 Ga0068855_100465358
181 Ga0068856_100063094
182 Ga0068863_100432616
183 Ga0068860_100013375
184 Ga0081455_10056587
185 Ga0070716_100003737
186 Ga0070716_100016937
187 Ga0070712_100247798
188 Ga0075436_100012878
189 Ga0075436_100043038
190 Ga0099794_10012705
191 Ga0099794_10018067
192 Ga0099794_10040399
193 Ga0099794_10047794
194 Ga0099794_10061408
195 Ga0099794_10214004
196 Ga0099794_10233935
197 Ga0099795_10073305
198 Ga0105240_10913399
199 Ga0105245_10200363
200 Ga0114129_10187673
201 Ga0105242_10188227
202 Ga0105248_10084477
203 Ga0105237_10216722
204 Ga0099796_10020897
205 Ga0105239_10103737
206 Ga0157370_10089487
207 Ga0157370_10610130
208 Ga0157370_10965120
209 Ga0157369_10058849
210 Ga0157369_10347184
211 Ga0157369_10505635
212 Ga0157369_10618091
213 Ga0157374_10008495
214 Ga0157372_10511003
215 Ga0157372_10879276
216 Ga0157375_10646785
217 Ga0197907_10160857
218 Ga0206349_1684059
219 Ga0206355_1705521
220 Ga0206351_10382910
221 Ga0213872_10001502
222 Ga0213876_10010031
223 Ga0213876_10023998
224 Ga0213875_10000017
225 Ga0213875_10021749
226 Ga0213875_10026073
227 Ga0213875_10039995
228 Ga0213875_10060006
229 Ga0224712_10038055
230 Ga0224712_10050095
231 Ga0224712_10088753
232 Ga0224572_1004228
233 Ga0207692_10510840
234 Ga0207699_10070963
235 Ga0207684_10486804
236 Ga0207707_10252007
237 Ga0207695_10137040
238 Ga0207671_10569601
239 Ga0207652_10243115
240 Ga0207700_10107043
241 Ga0207706_10911298
242 Ga0207686_10222996
243 Ga0207665_10000031
244 Ga0207665_10035514
245 Ga0207665_10579661
246 Ga0207661_10090061
247 Ga0207678_10199391
248 Ga0207702_10022078
249 Ga0207641_10318995
250 Ga0209588_1030247
251 Ga0209588_1053715
252 Ga0209588_1084612
253 Ga0209588_1102259
254 Ga0268264_10020337
255 Ga0265338_10020135
256 Ga0373943_0049024
257 Ga0373955_0246370
258 Ga0373935_0446159
259 Ga0373927_0093105
260 Ga0373947_0139961
261 Ga0395900_0617662
262 Ga0395898_0322590
263 Ga0436364_0026588
264 Ga0436364_0031339
265 Ga0436364_0074081
266 Ga0436364_0339530
267 Ga0436364_0373060
268 Ga0436364_0663079
269 Ga0436364_0679077
270 Ga0436364_0735144
271 Ga0436364_0770585
272 Ga0436364_1031181
273 Ga0436364_1160939
274 Ga0436364_1171574
275 Ga0436364_1198992
276 Ga0436364_1552384
277 Ga0436364_1560898
278 Ga0436365_0027270
279 Ga0436365_0801212
280 Ga0436365_0927493
281 Ga0436365_1067054
282 Ga0436365_1122548
283 Ga0436360_0626405
284 Ga0436360_1140368
285 Ga0436361_0761235
286 Ga0436363_0317412
287 Ga0436362_0090188
288 Ga0436362_0827255
289 Ga0466968_0145919
290 Ga0495580_0178144
291 Ga0495580_0632634
292 Ga0495582_0113650
293 Ga0495594_0126731
294 Ga0495586_0291888
295 Ga0495645_0188105
296 Ga0495658_0054683
297 Ga0495581_0152280
298 Ga0495680_0429168
299 Ga0495684_0236571
300 Ga0496100_0394351
301 Ga0496102_0007799
302 Ga0496103_0165216
303 Ga0496105_0042513
304 Ga0496108_0175178
305 Ga0496112_0038563
306 Ga0496112_0458578
307 Ga0501046_0236180
308 Ga0501047_0004180
309 Ga0501047_0029783
310 Ga0501047_0165055
311 Ga0501070_0036629
312 Ga0501073_0476269
313 Ga0501035_0010694
314 Ga0501035_0221741
315 Ga0501044_0000165
316 Ga0501044_0000665
317 Ga0501044_0295230
318 nmdc:mga05p37_155853_c1
319 nmdc:mga08x19_15049_c2
320 nmdc:mga08x19_178539_c1
321 nmdc:mga08x19_730133_c1
322 Ga0495612_0048767

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01966

HD

HD domain

41

139

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3p3q-assembly3.cif.gz_A crystal structure of mmoq response regulator from methylococcus capsulatus str. bath at the resolution 2.4a, northeast structural genomics consortium target mcr175m 0.6358 11 178
4s1b-assembly3.cif.gz_A crystal structure of l. monocytogenes phosphodiesterase pgph hd domain in complex with cyclic-di-amp 0.5825 9 187
4s1c-assembly3.cif.gz_D-2 crystal structure of l. monocytogenes phosphodiesterase pgph hd domain 0.5821 10 188
4s1b-assembly3.cif.gz_D-2 crystal structure of l. monocytogenes phosphodiesterase pgph hd domain in complex with cyclic-di-amp 0.5781 10 187
7qoe-assembly1.cif.gz_A-2 structure of a small alarmone hydrolase from leptospira levettii 0.575 5 181
ID Description Score Start End Superfamily
af_B6SZF0_2_101_1.10.472.50 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;HD-domain/PDEase-like 0.6723 5 93 1.10.472.50
af_Q2FZ08_320_474_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6231 7 150 1.10.3210.10
af_B6SZF0_2_101_1.10.472.50 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;HD-domain/PDEase-like 0.6073 5 93 1.10.472.50
2pjqD01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;HD-domain/PDEase-like 0.5976 3 94 1.10.472.50
2pjqD01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;HD-domain/PDEase-like 0.5875 3 94 1.10.472.50
ID Description Score Start End GO Terms
AF-A0A845U6B3-F1-model_v4 HDIG domain-containing protein 0.9977 4 191
AF-A0A7V1H481-F1-model_v4 HAD family hydrolase 0.9908 114 189 GO:0016787
AF-A0A2V7IHX2-F1-model_v4 HAD family hydrolase 0.9882 3 189 GO:0016787
AF-A0A7W1YN25-F1-model_v4 HDIG domain-containing protein 0.9871 1 191
AF-A0A0G1PBS8-F1-model_v4 Metal dependent phosphohydrolase 0.9837 89 189 GO:0016787

Map