F237530

General Info

Members Datasets Scaffolds Average Seq Length
161 114 322 304

Family's Representative Sequence

Representative Sequence 3300042004|Ga0439445_0019730|Ga0439445_0019730_18_1007
Length 329
Sequence MGVLDRLFNVGRGSAFAALSKRAASPLSRRASSSAGVDDDLFDDEFQRKLDYLAMVSRRVFSGAMRAERRTKKTGSGVEFADHRDYAPGDDFRYLDWHAYQRFDRLLIRLYEEEEDLSIYFILDSSSSMGFGGAEKLRQAKRLCAALAYVGLANLDRIAIVTATDEISGRTQSTRGKARIFRVFRFLSGVRAEGVTDLGEAMKTFVAQHKRRGLAVILSDLYDPAGFERGINVLRYAKFEPYVLHLVDPSDGKPSLKGDVRVYDCETGEEREVTVTAKVLERYAKAYEEYLEEVQRFCTSRQVSYFRADVSVPFDELILRVFRRGGFLR

Samples

Sample ID Description Type Environment
1 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
40 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
58 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
59 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
60 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
61 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
62 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
63 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
64 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
65 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
66 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
67 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
68 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
69 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
70 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
71 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
72 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
73 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
74 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
75 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
76 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
77 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
78 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
79 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
80 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
81 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
82 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
83 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
84 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
85 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
86 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
87 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
88 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
89 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
90 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
93 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
94 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
95 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
96 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
97 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
98 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
99 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
102 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
104 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
105 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
106 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
107 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
108 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
109 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
110 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
111 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
112 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
113 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
114 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.86
Rhizosphere 89.44
Stem 0
Stem Tuber 0
Unclassified 6.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439445_0019730 3300042004 Bacteria 1682
2 rootH1_10024532 3300003316 Unclassified 2039
3 rootH2_10056746 3300003320 Unclassified 4936
4 rootL2_10105811 3300003322 Unclassified 4538
5 rootH1_10164637 3300003323 Bacteria 3005
6 Ga0070683_100005999 3300005329 Bacteria 10177
7 Ga0070683_100194520 3300005329 Bacteria 1926
8 Ga0070683_100218342 3300005329 Bacteria 1812
9 Ga0070683_100476361 3300005329 Bacteria 1192
10 Ga0070682_100015286 3300005337 Bacteria 4445
11 Ga0068868_100002524 3300005338 Bacteria 12713
12 Ga0070691_10143454 3300005341 Bacteria 1219
13 Ga0070675_100147818 3300005354 Bacteria 2013
14 Ga0070681_10046490 3300005458 Bacteria 4340
15 Ga0068867_100159496 3300005459 Bacteria 1778
16 Ga0070706_100032897 3300005467 Bacteria 4784
17 Ga0070679_100004759 3300005530 Bacteria 12519
18 Ga0070679_100024408 3300005530 Bacteria 5924
19 Ga0070679_100132781 3300005530 Unclassified 2470
20 Ga0070684_100175635 3300005535 Bacteria 1947
21 Ga0070672_100000273 3300005543 Bacteria 29226
22 Ga0070672_100308752 3300005543 Bacteria 1342
23 Ga0070665_100033232 3300005548 Bacteria 5191
24 Ga0068855_100006510 3300005563 Bacteria 14202
25 Ga0068855_100010670 3300005563 Bacteria 11084
26 Ga0068855_100641192 3300005563 Unclassified 1142
27 Ga0068857_100097526 3300005577 Bacteria 2636
28 Ga0068856_100005259 3300005614 Bacteria 12764
29 Ga0068856_100049874 3300005614 Bacteria 4126
30 Ga0068859_100849408 3300005617 Bacteria 999
31 Ga0068864_100018519 3300005618 Bacteria 5819
32 Ga0068863_100078572 3300005841 Bacteria 3125
33 Ga0068858_100304947 3300005842 Bacteria 1520
34 Ga0081455_10023966 3300005937 Bacteria 5663
35 Ga0075430_100031782 3300006846 Bacteria 4480
36 Ga0075431_100068862 3300006847 Bacteria 3652
37 Ga0075429_100097637 3300006880 Bacteria 2563
38 Ga0075429_100098962 3300006880 Bacteria 2545
39 Ga0111539_10012565 3300009094 Bacteria 10610
40 Ga0111539_10317115 3300009094 Unclassified 1814
41 Ga0105245_10003695 3300009098 Bacteria 13657
42 Ga0105247_10004642 3300009101 Bacteria 8759
43 Ga0114129_10155831 3300009147 Bacteria 3124
44 Ga0105241_10011549 3300009174 Bacteria 6475
45 Ga0105248_10904414 3300009177 Bacteria 997
46 Ga0105237_10378570 3300009545 Bacteria 1420
47 Ga0157374_10153961 3300013296 Bacteria 2237
48 Ga0157374_10515713 3300013296 Bacteria 1201
49 Ga0157378_10458933 3300013297 Bacteria 1266
50 Ga0157379_10351523 3300014968 Bacteria 1349
51 Ga0157376_10026628 3300014969 Bacteria 4572
52 Ga0157376_10728421 3300014969 Bacteria 999
53 Ga0207710_10001620 3300025900 Bacteria 11006
54 Ga0207684_10214917 3300025910 Bacteria 1659
55 Ga0207654_10005369 3300025911 Bacteria 6476
56 Ga0207707_10032150 3300025912 Bacteria 4594
57 Ga0207660_10097072 3300025917 Bacteria 2195
58 Ga0207652_10003360 3300025921 Bacteria 13215
59 Ga0207652_10062595 3300025921 Bacteria 3215
60 Ga0207652_10090135 3300025921 Bacteria 2694
61 Ga0207652_10244543 3300025921 Bacteria 1618
62 Ga0207652_10276085 3300025921 Bacteria 1516
63 Ga0207670_10046249 3300025936 Bacteria 2890
64 Ga0207691_10000877 3300025940 Bacteria 29932
65 Ga0207711_10415460 3300025941 Bacteria 1251
66 Ga0207661_10033677 3300025944 Bacteria 3978
67 Ga0207661_10148259 3300025944 Bacteria 2026
68 Ga0207661_10349833 3300025944 Bacteria 1333
69 Ga0207667_10002603 3300025949 Bacteria 22387
70 Ga0207667_10006484 3300025949 Bacteria 14157
71 Ga0207677_10004228 3300026023 Bacteria 7687
72 Ga0207677_10247276 3300026023 Bacteria 1446
73 Ga0207702_10072057 3300026078 Bacteria 2977
74 Ga0207702_10242557 3300026078 Bacteria 1689
75 Ga0207702_10590355 3300026078 Unclassified 1089
76 Ga0207648_10131744 3300026089 Bacteria 2201
77 Ga0207676_10248054 3300026095 Bacteria 1601
78 Ga0207674_10166095 3300026116 Bacteria 2161
79 Ga0207683_10047250 3300026121 Bacteria 3770
80 Ga0207683_10172768 3300026121 Bacteria 1958
81 Ga0207428_10346196 3300027907 Unclassified 1094
82 Ga0265337_1000642 3300028556 Bacteria 18486
83 Ga0265319_1000064 3300028563 Bacteria 85497
84 Ga0265334_10052276 3300028573 Bacteria 1564
85 Ga0265318_10000134 3300028577 Bacteria 68385
86 Ga0265318_10001807 3300028577 Bacteria 12168
87 Ga0307515_10223695 3300028794 Bacteria 1693
88 Ga0265338_10087230 3300028800 Bacteria 2593
89 Ga0307511_10034193 3300030521 Bacteria 4468
90 Ga0265330_10000121 3300031235 Bacteria 63545
91 Ga0265332_10000075 3300031238 Bacteria 84887
92 Ga0265328_10004578 3300031239 Bacteria 5997
93 Ga0265320_10000077 3300031240 Bacteria 84445
94 Ga0265320_10002377 3300031240 Bacteria 13157
95 Ga0265320_10045622 3300031240 Bacteria 2152
96 Ga0265325_10020060 3300031241 Bacteria 3689
97 Ga0265329_10000012 3300031242 Bacteria 70717
98 Ga0265340_10000354 3300031247 Bacteria 24426
99 Ga0265340_10000663 3300031247 Bacteria 19291
100 Ga0265339_10003505 3300031249 Bacteria 10959
101 Ga0265331_10001625 3300031250 Bacteria 16412
102 Ga0265316_10000283 3300031344 Bacteria 56999
103 Ga0265316_10006121 3300031344 Bacteria 11543
104 Ga0307513_10046536 3300031456 Unclassified 4728
105 Ga0307513_10148715 3300031456 Bacteria 2256
106 Ga0307509_10094418 3300031507 Bacteria 3050
107 Ga0265313_10000105 3300031595 Bacteria 84446
108 Ga0265313_10000213 3300031595 Bacteria 62301
109 Ga0265314_10000223 3300031711 Bacteria 84419
110 Ga0265314_10038615 3300031711 Bacteria 3447
111 Ga0265342_10000129 3300031712 Bacteria 84384
112 Ga0265342_10028912 3300031712 Bacteria 3446
113 Ga0265342_10054883 3300031712 Bacteria 2367
114 Ga0316576_10089723 3300031727 Bacteria 2289
115 Ga0316576_10214083 3300031727 Bacteria 1450
116 Ga0307516_10006108 3300031730 Bacteria 14211
117 Ga0307412_10013647 3300031911 Bacteria 4772
118 Ga0307411_10230352 3300032005 Bacteria 1444
119 Ga0307507_10013427 3300033179 Bacteria 9945
120 Ga0373923_0057360 3300035111 Bacteria 1647
121 Ga0373953_0199736 3300035117 Bacteria 865
122 Ga0373943_0011349 3300035170 Bacteria 4008
123 Ga0316574_0056107 3300035398 Bacteria 2464
124 Ga0373931_0289114 3300035691 Bacteria 1009
125 Ga0373935_0200499 3300035692 Bacteria 1379
126 Ga0373937_0366906 3300036401 Bacteria 1365
127 Ga0316582_0198169 3300036647 Bacteria 1369
128 Ga0316582_0280538 3300036647 Bacteria 1143
129 Ga0373925_0023515 3300037068 Bacteria 4497
130 Ga0451789_1012768 3300041443 Bacteria 990
131 Ga0451807_0594650 3300041486 Bacteria 3498
132 Ga0451837_0470698 3300041494 Bacteria 1087
133 Ga0451851_0683427 3300041507 Bacteria 1655
134 Ga0451853_2019126 3300041512 Bacteria 21309
135 Ga0439445_0025156 3300042004 Bacteria 1517
136 Ga0451576_0031982 3300045051 Bacteria 5608
137 Ga0466967_0433948 3300045976 Bacteria 1282
138 Ga0496112_0049222 3300048915 Bacteria 4131
139 Ga0501034_0014983 3300049571 Bacteria 7975
140 Ga0501073_0004549 3300049589 Bacteria 10427
141 Ga0501076_0063257 3300049592 Bacteria 2948
142 Ga0501080_0000583 3300049742 Bacteria 28870
143 Ga0501080_0017724 3300049742 Bacteria 6590
144 Ga0501083_0002824 3300049744 Bacteria 11995
145 Ga0501083_0037840 3300049744 Bacteria 3283
146 Ga0501035_0068630 3300049822 Bacteria 3143
147 Ga0501035_0122322 3300049822 Bacteria 2274
148 nmdc:mga09592_31507_c1 3300050508 Bacteria 4419
149 nmdc:mga09592_454180_c1 3300050508 Bacteria 1105
150 nmdc:mga09592_73741_c1 3300050508 Bacteria 2900
151 nmdc:mga09592_94774_c1 3300050508 Bacteria 2553
152 nmdc:mga0qj67_9576_c1 3300050509 Bacteria 7220
153 nmdc:mga06r32_64466_c1 3300050510 Bacteria 3533
154 nmdc:mga08y16_25840_c1 3300050511 Bacteria 6195
155 nmdc:mga08y16_293111_c1 3300050511 Bacteria 1677
156 nmdc:mga08y16_6291_c1 3300050511 Bacteria 12450
157 nmdc:mga08x19_39001_c1 3300050514 Bacteria 3018
158 Ga0501084_0001695 3300054114 Bacteria 17510
159 Ga0501084_0034154 3300054114 Bacteria 4252
160 Ga0501084_0046996 3300054114 Unclassified 3615
161 Ga0466962_0018898 3300061719 Bacteria 3312
162 Ga0439445_0019730
163 rootH1_10024532
164 rootH2_10056746
165 rootL2_10105811
166 rootH1_10164637
167 Ga0070683_100005999
168 Ga0070683_100194520
169 Ga0070683_100218342
170 Ga0070683_100476361
171 Ga0070682_100015286
172 Ga0068868_100002524
173 Ga0070691_10143454
174 Ga0070675_100147818
175 Ga0070681_10046490
176 Ga0068867_100159496
177 Ga0070706_100032897
178 Ga0070679_100004759
179 Ga0070679_100024408
180 Ga0070679_100132781
181 Ga0070684_100175635
182 Ga0070672_100000273
183 Ga0070672_100308752
184 Ga0070665_100033232
185 Ga0068855_100006510
186 Ga0068855_100010670
187 Ga0068855_100641192
188 Ga0068857_100097526
189 Ga0068856_100005259
190 Ga0068856_100049874
191 Ga0068859_100849408
192 Ga0068864_100018519
193 Ga0068863_100078572
194 Ga0068858_100304947
195 Ga0081455_10023966
196 Ga0075430_100031782
197 Ga0075431_100068862
198 Ga0075429_100097637
199 Ga0075429_100098962
200 Ga0111539_10012565
201 Ga0111539_10317115
202 Ga0105245_10003695
203 Ga0105247_10004642
204 Ga0114129_10155831
205 Ga0105241_10011549
206 Ga0105248_10904414
207 Ga0105237_10378570
208 Ga0157374_10153961
209 Ga0157374_10515713
210 Ga0157378_10458933
211 Ga0157379_10351523
212 Ga0157376_10026628
213 Ga0157376_10728421
214 Ga0207710_10001620
215 Ga0207684_10214917
216 Ga0207654_10005369
217 Ga0207707_10032150
218 Ga0207660_10097072
219 Ga0207652_10003360
220 Ga0207652_10062595
221 Ga0207652_10090135
222 Ga0207652_10244543
223 Ga0207652_10276085
224 Ga0207670_10046249
225 Ga0207691_10000877
226 Ga0207711_10415460
227 Ga0207661_10033677
228 Ga0207661_10148259
229 Ga0207661_10349833
230 Ga0207667_10002603
231 Ga0207667_10006484
232 Ga0207677_10004228
233 Ga0207677_10247276
234 Ga0207702_10072057
235 Ga0207702_10242557
236 Ga0207702_10590355
237 Ga0207648_10131744
238 Ga0207676_10248054
239 Ga0207674_10166095
240 Ga0207683_10047250
241 Ga0207683_10172768
242 Ga0207428_10346196
243 Ga0265337_1000642
244 Ga0265319_1000064
245 Ga0265334_10052276
246 Ga0265318_10000134
247 Ga0265318_10001807
248 Ga0307515_10223695
249 Ga0265338_10087230
250 Ga0307511_10034193
251 Ga0265330_10000121
252 Ga0265332_10000075
253 Ga0265328_10004578
254 Ga0265320_10000077
255 Ga0265320_10002377
256 Ga0265320_10045622
257 Ga0265325_10020060
258 Ga0265329_10000012
259 Ga0265340_10000354
260 Ga0265340_10000663
261 Ga0265339_10003505
262 Ga0265331_10001625
263 Ga0265316_10000283
264 Ga0265316_10006121
265 Ga0307513_10046536
266 Ga0307513_10148715
267 Ga0307509_10094418
268 Ga0265313_10000105
269 Ga0265313_10000213
270 Ga0265314_10000223
271 Ga0265314_10038615
272 Ga0265342_10000129
273 Ga0265342_10028912
274 Ga0265342_10054883
275 Ga0316576_10089723
276 Ga0316576_10214083
277 Ga0307516_10006108
278 Ga0307412_10013647
279 Ga0307411_10230352
280 Ga0307507_10013427
281 Ga0373923_0057360
282 Ga0373953_0199736
283 Ga0373943_0011349
284 Ga0316574_0056107
285 Ga0373931_0289114
286 Ga0373935_0200499
287 Ga0373937_0366906
288 Ga0316582_0198169
289 Ga0316582_0280538
290 Ga0373925_0023515
291 Ga0451789_1012768
292 Ga0451807_0594650
293 Ga0451837_0470698
294 Ga0451851_0683427
295 Ga0451853_2019126
296 Ga0439445_0025156
297 Ga0451576_0031982
298 Ga0466967_0433948
299 Ga0496112_0049222
300 Ga0501034_0014983
301 Ga0501073_0004549
302 Ga0501076_0063257
303 Ga0501080_0000583
304 Ga0501080_0017724
305 Ga0501083_0002824
306 Ga0501083_0037840
307 Ga0501035_0068630
308 Ga0501035_0122322
309 nmdc:mga09592_31507_c1
310 nmdc:mga09592_454180_c1
311 nmdc:mga09592_73741_c1
312 nmdc:mga09592_94774_c1
313 nmdc:mga0qj67_9576_c1
314 nmdc:mga06r32_64466_c1
315 nmdc:mga08y16_25840_c1
316 nmdc:mga08y16_293111_c1
317 nmdc:mga08y16_6291_c1
318 nmdc:mga08x19_39001_c1
319 Ga0501084_0001695
320 Ga0501084_0034154
321 Ga0501084_0046996
322 Ga0466962_0018898

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01882

DUF58

Protein of unknown function DUF58

77

160

0.94

PF13519

VWA_2

von Willebrand factor type A domain

119

222

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ft6-assembly1.cif.gz_A the von willebrand factor a domain of human capillary morphogenesis gene ii, flexibly fused to the 1tel crystallization chaperone, ala-ala linker variant, sumo tag-free preparation. 0.7861 79 209
1sht-assembly1.cif.gz_X crystal structure of the von willebrand factor a domain of human capillary morphogenesis protein 2: an anthrax toxin receptor 0.7835 77 209
8fz4-assembly2.cif.gz_B the von willebrand factor a domain of anthrax toxin receptor 2 0.769 77 209
4fx5-assembly1.cif.gz_A von willebrand factor type a from catenulispora acidiphila 0.7503 77 209
8fzu-assembly2.cif.gz_B the von willebrand factor a domain of human capillary morphogenesis gene ii, flexibly fused to the 1tel crystallization chaperone, thr-val linker variant, expressed with sumo tag 0.7467 65 209
ID Description Score Start End Superfamily
af_P9WLX5_142_317_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.8175 125 282 3.40.50.410
af_A0A0P0XV48_261_417_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.7867 81 179 3.40.50.410
af_A0A1D6JNC8_203_394_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.7815 81 179 3.40.50.410
af_Q76NM2_26_240_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.7607 78 207 3.40.50.410
af_Q66H58_3_138_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.757 82 171 3.40.50.410
ID Description Score Start End GO Terms
AF-A0A2G6CQ44-F1-model_v4 DUF58 domain-containing protein 0.9544 76 291
AF-A0A1V6D5S4-F1-model_v4 DUF58 domain-containing protein 0.9394 75 285
AF-A0A1F8ZZP0-F1-model_v4 DUF58 domain-containing protein 0.9339 76 207
AF-A0A0S8EFA8-F1-model_v4 DUF58 domain-containing protein 0.9335 76 159
AF-A0A1Z8NSY3-F1-model_v4 VWFA domain-containing protein 0.9329 74 291

Map