F237280

General Info

Members Datasets Scaffolds Average Seq Length
161 112 161 176

Family's Representative Sequence

Representative Sequence 3300031238|Ga0265332_10011288|Ga0265332_100112885
Length 212
Sequence MGSRKRSSHSAKPALPARRAPTPRGVAQTKPPSATEPRDSMAYVRHLVRDIPDFPKSGILFRDITPLLADPRGFHITLDAIAERFVGEHADAIVAVESRGFIFGGALAARLNASFVPVRKPGKLPATTDRVKYSLEYGEGELEMHEDALPSGARVIVMDDLLATGGTAAAAGELVRRQDAIVIAYAFVLELEFLGGRARLAPTPVESLIRYA

Samples

Sample ID Description Type Environment
1 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
2 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
3 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
6 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
7 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
47 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
63 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
64 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
65 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
66 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
67 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
68 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
69 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
70 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
71 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
72 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
73 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
76 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
77 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
78 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
79 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
80 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
81 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
82 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
83 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
84 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
85 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
86 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
87 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
88 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
89 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
90 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
91 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
92 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
93 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
94 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
95 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
96 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
97 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
98 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
99 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
101 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
102 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
103 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
104 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
105 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
106 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
107 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
108 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
109 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
110 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
111 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
112 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.86
Rhizosphere 95.03
Stem 0
Stem Tuber 0
Unclassified 3.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100089930 3300005340 Bacteria 2418
2 Ga0070673_100016952 3300005364 Bacteria 5167
3 Ga0070688_100053534 3300005365 Unclassified 2525
4 Ga0070688_100611093 3300005365 Bacteria 835
5 Ga0070713_100175704 3300005436 Bacteria 1922
6 Ga0070701_10385822 3300005438 Bacteria 884
7 Ga0070705_100015021 3300005440 Bacteria 3995
8 Ga0070700_100120578 3300005441 Unclassified 1757
9 Ga0070694_100114488 3300005444 Bacteria 1926
10 Ga0070708_100082986 3300005445 Bacteria 2904
11 Ga0070681_10227452 3300005458 Bacteria 1780
12 Ga0070685_10234032 3300005466 Bacteria 1210
13 Ga0070706_100333754 3300005467 Bacteria 1414
14 Ga0070706_100660057 3300005467 Bacteria 971
15 Ga0070697_100594702 3300005536 Bacteria 972
16 Ga0070686_100015693 3300005544 Bacteria 4394
17 Ga0070695_101053849 3300005545 Bacteria 663
18 Ga0070696_100017129 3300005546 Bacteria 4890
19 Ga0070665_101247118 3300005548 Bacteria 754
20 Ga0070704_100000762 3300005549 Bacteria 15854
21 Ga0070704_100054432 3300005549 Bacteria 2831
22 Ga0070704_100115143 3300005549 Unclassified 2054
23 Ga0068859_101308552 3300005617 Bacteria 799
24 Ga0068864_100791060 3300005618 Unclassified 932
25 Ga0068861_100880347 3300005719 Unclassified 847
26 Ga0068863_100229016 3300005841 Bacteria 1792
27 Ga0068860_100128003 3300005843 Unclassified 2435
28 Ga0068862_101036367 3300005844 Unclassified 813
29 Ga0081539_10001205 3300005985 Bacteria 46620
30 Ga0075428_100018689 3300006844 Bacteria 7662
31 Ga0075428_100192827 3300006844 Bacteria 2204
32 Ga0075428_101876994 3300006844 Unclassified 623
33 Ga0075431_100067680 3300006847 Bacteria 3687
34 Ga0075431_100232807 3300006847 Bacteria 1876
35 Ga0075431_100328907 3300006847 Bacteria 1540
36 Ga0075431_101292622 3300006847 Bacteria 691
37 Ga0075433_10225623 3300006852 Bacteria 1664
38 Ga0075434_100348862 3300006871 Bacteria 1501
39 Ga0075434_100401783 3300006871 Bacteria 1391
40 Ga0075434_100561670 3300006871 Bacteria 1161
41 Ga0075429_100011174 3300006880 Bacteria 7772
42 Ga0075429_100186545 3300006880 Bacteria 1817
43 Ga0075429_100644435 3300006880 Bacteria 928
44 Ga0075436_100146320 3300006914 Bacteria 1662
45 Ga0097620_101308223 3300006931 Bacteria 799
46 Ga0105240_10042586 3300009093 Bacteria 5785
47 Ga0111539_10733579 3300009094 Unclassified 1150
48 Ga0105247_10052291 3300009101 Unclassified 2518
49 Ga0114129_10064271 3300009147 Bacteria 5121
50 Ga0114129_10262966 3300009147 Bacteria 2311
51 Ga0114129_10457465 3300009147 Bacteria 1673
52 Ga0105249_10325835 3300009553 Unclassified 1548
53 Ga0105246_11362963 3300011119 Unclassified 660
54 Ga0157370_10403184 3300013104 Bacteria 1259
55 Ga0157378_10199441 3300013297 Bacteria 1892
56 Ga0163163_10222081 3300014325 Unclassified 1938
57 Ga0157380_10122125 3300014326 Bacteria 2208
58 Ga0157379_11288237 3300014968 Unclassified 705
59 Ga0157376_10092335 3300014969 Bacteria 2624
60 Ga0163161_10187802 3300017792 Unclassified 1587
61 Ga0213876_10358461 3300021384 Bacteria 776
62 Ga0207688_10165958 3300025901 Bacteria 1311
63 Ga0207684_10111886 3300025910 Bacteria 2337
64 Ga0207707_10159079 3300025912 Bacteria 1975
65 Ga0207695_10031956 3300025913 Bacteria 5765
66 Ga0207662_10012290 3300025918 Bacteria 4765
67 Ga0207646_10481594 3300025922 Bacteria 1119
68 Ga0207700_10332357 3300025928 Bacteria 1319
69 Ga0207711_10131321 3300025941 Bacteria 2246
70 Ga0207712_10171162 3300025961 Unclassified 1698
71 Ga0207677_10165365 3300026023 Bacteria 1724
72 Ga0207703_11062695 3300026035 Bacteria 777
73 Ga0207708_10115548 3300026075 Unclassified 2087
74 Ga0207702_10387678 3300026078 Bacteria 1345
75 Ga0207702_11059292 3300026078 Bacteria 805
76 Ga0207676_10464300 3300026095 Unclassified 1196
77 Ga0207675_100116392 3300026118 Bacteria 2526
78 Ga0265338_10024603 3300028800 Bacteria 6145
79 Ga0265332_10011288 3300031238 Bacteria 3972
80 Ga0265332_10140899 3300031238 Bacteria 1010
81 Ga0265320_10000470 3300031240 Bacteria 31538
82 Ga0265320_10002116 3300031240 Bacteria 13961
83 Ga0265320_10062091 3300031240 Unclassified 1780
84 Ga0265325_10226290 3300031241 Unclassified 854
85 Ga0265339_10001693 3300031249 Bacteria 16264
86 Ga0265339_10062049 3300031249 Bacteria 2010
87 Ga0307513_10307165 3300031456 Bacteria 1350
88 Ga0265313_10081853 3300031595 Unclassified 1465
89 Ga0307508_10027690 3300031616 Bacteria 5129
90 Ga0265342_10000276 3300031712 Bacteria 57738
91 Ga0265342_10102134 3300031712 Bacteria 1632
92 Ga0316576_10000216 3300031727 Bacteria 24373
93 Ga0316576_10302080 3300031727 Bacteria 1196
94 Ga0316578_10068812 3300031728 Bacteria 2094
95 Ga0316578_10221575 3300031728 Bacteria 1137
96 Ga0307410_10756825 3300031852 Bacteria 823
97 Ga0307409_100351204 3300031995 Bacteria 1391
98 Ga0307411_10960540 3300032005 Bacteria 763
99 Ga0373943_0026872 3300035170 Bacteria 2700
100 Ga0373947_0037301 3300035725 Bacteria 2884
101 Ga0373937_1088648 3300036401 Bacteria 748
102 Ga0316584_0000162 3300036712 Bacteria 31170
103 Ga0436365_1484898 3300039437 Bacteria 1765
104 Ga0436360_0400802 3300039438 Bacteria 2519
105 Ga0451841_0875738 3300041498 Bacteria 1282
106 Ga0451577_0000063 3300042876 Bacteria 264379
107 Ga0451577_0209262 3300042876 Bacteria 1762
108 Ga0451577_0935944 3300042876 Bacteria 779
109 Ga0453683_0004676 3300044673 Bacteria 9660
110 Ga0453683_0040616 3300044673 Bacteria 2920
111 Ga0453683_0040838 3300044673 Bacteria 2912
112 Ga0453683_0050442 3300044673 Bacteria 2607
113 Ga0453683_0444587 3300044673 Bacteria 838
114 Ga0453684_0000198 3300044712 Bacteria 264379
115 Ga0453684_0046009 3300044712 Bacteria 5812
116 Ga0451576_0002685 3300045051 Bacteria 25909
117 Ga0451576_0024078 3300045051 Bacteria 6579
118 Ga0451576_0030965 3300045051 Bacteria 5708
119 Ga0451576_0038608 3300045051 Bacteria 5053
120 Ga0451576_0039524 3300045051 Bacteria 4993
121 Ga0451576_0226852 3300045051 Bacteria 1950
122 Ga0495629_0164290 3300046459 Bacteria 1542
123 Ga0495641_0307770 3300046461 Unclassified 714
124 Ga0495664_0090328 3300046477 Bacteria 1841
125 Ga0495618_0232639 3300046514 Bacteria 1160
126 Ga0495628_0518057 3300046516 Bacteria 859
127 Ga0495630_0074409 3300046517 Bacteria 2558
128 Ga0495634_0001216 3300046642 Bacteria 23760
129 Ga0495634_0485806 3300046642 Bacteria 725
130 Ga0495599_0425640 3300046678 Bacteria 788
131 Ga0495658_0321476 3300046683 Bacteria 981
132 Ga0495674_0015530 3300047319 Bacteria 7115
133 Ga0496106_0589365 3300048909 Bacteria 891
134 Ga0496114_0027172 3300048917 Bacteria 4686
135 Ga0496114_0067319 3300048917 Bacteria 3004
136 Ga0501034_0765133 3300049571 Bacteria 860
137 Ga0501067_0000064 3300049583 Bacteria 60217
138 Ga0501067_0001119 3300049583 Bacteria 14517
139 Ga0501067_0431528 3300049583 Bacteria 735
140 Ga0501070_0207690 3300049586 Bacteria 1608
141 Ga0501073_0004074 3300049589 Bacteria 10964
142 Ga0501073_0011997 3300049589 Bacteria 6327
143 Ga0501073_0091036 3300049589 Bacteria 2120
144 nmdc:mga05p37_121090_c1 3300050507 Bacteria 3214
145 nmdc:mga05p37_229674_c1 3300050507 Bacteria 2236
146 nmdc:mga05p37_289421_c1 3300050507 Unclassified 1950
147 nmdc:mga05p37_474210_c1 3300050507 Bacteria 1443
148 nmdc:mga09592_11849_c1 3300050508 Bacteria 7093
149 nmdc:mga09592_402966_c1 3300050508 Bacteria 1182
150 nmdc:mga09592_98234_c1 3300050508 Bacteria 2506
151 nmdc:mga09592_98998_c1 3300050508 Bacteria 2496
152 nmdc:mga0qj67_102673_c1 3300050509 Bacteria 2306
153 nmdc:mga06r32_1175216_c1 3300050510 Bacteria 714
154 nmdc:mga06r32_165814_c1 3300050510 Bacteria 2192
155 nmdc:mga06r32_712358_c1 3300050510 Bacteria 969
156 nmdc:mga0n895_298166_c1 3300050512 Bacteria 1634
157 nmdc:mga0rr50_231652_c1 3300050513 Bacteria 1528
158 nmdc:mga08x19_156679_c1 3300050514 Bacteria 1545
159 nmdc:mga0a205_219965_c1 3300050515 Bacteria 1785
160 Ga0501084_0106821 3300054114 Bacteria 2352
161 Ga0501082_1047056 3300060353 Bacteria 713

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006880 Ga0075429_100644435 Ga0075429_1006444352 148
2 3300005440 Ga0070705_100015021 Ga0070705_1000150214 169
3 3300005444 Ga0070694_100114488 Ga0070694_1001144882 169
4 3300005467 Ga0070706_100660057 Ga0070706_1006600573 169
5 3300005545 Ga0070695_101053849 Ga0070695_1010538491 169
6 3300005546 Ga0070696_100017129 Ga0070696_1000171294 169
7 3300005549 Ga0070704_100000762 Ga0070704_1000007625 169
8 3300005549 Ga0070704_100054432 Ga0070704_1000544324 169
9 3300006844 Ga0075428_100018689 Ga0075428_10001868911 169
10 3300006847 Ga0075431_100328907 Ga0075431_1003289072 169
11 3300006880 Ga0075429_100011174 Ga0075429_1000111745 169
12 3300006880 Ga0075429_100186545 Ga0075429_1001865452 169
13 3300050507 nmdc:mga05p37_229674_c1 nmdc:mga05p37_229674_c1_1535_2065 169
14 3300050508 nmdc:mga09592_11849_c1 nmdc:mga09592_11849_c1_1622_2152 169
15 3300050508 nmdc:mga09592_98234_c1 nmdc:mga09592_98234_c1_561_1091 169
16 3300050510 nmdc:mga06r32_712358_c1 nmdc:mga06r32_712358_c1_316_846 169
17 3300005365 Ga0070688_100053534 Ga0070688_1000535342 170
18 3300005441 Ga0070700_100120578 Ga0070700_1001205782 170
19 3300005467 Ga0070706_100333754 Ga0070706_1003337542 170
20 3300005536 Ga0070697_100594702 Ga0070697_1005947022 170
21 3300005548 Ga0070665_101247118 Ga0070665_1012471182 170
22 3300005549 Ga0070704_100115143 Ga0070704_1001151433 170
23 3300005617 Ga0068859_101308552 Ga0068859_1013085522 170
24 3300005618 Ga0068864_100791060 Ga0068864_1007910602 170
25 3300005719 Ga0068861_100880347 Ga0068861_1008803472 170
26 3300005843 Ga0068860_100128003 Ga0068860_1001280034 170
27 3300005844 Ga0068862_101036367 Ga0068862_1010363672 170
28 3300005985 Ga0081539_10001205 Ga0081539_1000120526 170
29 3300006844 Ga0075428_101876994 Ga0075428_1018769941 170
30 3300006871 Ga0075434_100348862 Ga0075434_1003488622 170
31 3300006931 Ga0097620_101308223 Ga0097620_1013082232 170
32 3300009094 Ga0111539_10733579 Ga0111539_107335792 170
33 3300009101 Ga0105247_10052291 Ga0105247_100522913 170
34 3300009147 Ga0114129_10064271 Ga0114129_100642713 170
35 3300009147 Ga0114129_10457465 Ga0114129_104574652 170
36 3300009553 Ga0105249_10325835 Ga0105249_103258353 170
37 3300011119 Ga0105246_11362963 Ga0105246_113629632 170
38 3300014325 Ga0163163_10222081 Ga0163163_102220813 170
39 3300014326 Ga0157380_10122125 Ga0157380_101221251 170
40 3300014968 Ga0157379_11288237 Ga0157379_112882372 170
41 3300017792 Ga0163161_10187802 Ga0163161_101878022 170
42 3300025901 Ga0207688_10165958 Ga0207688_101659582 170
43 3300025910 Ga0207684_10111886 Ga0207684_101118862 170
44 3300025922 Ga0207646_10481594 Ga0207646_104815941 170
45 3300025961 Ga0207712_10171162 Ga0207712_101711622 170
46 3300026075 Ga0207708_10115548 Ga0207708_101155481 170
47 3300026095 Ga0207676_10464300 Ga0207676_104643002 170
48 3300026118 Ga0207675_100116392 Ga0207675_1001163922 170
49 3300036401 Ga0373937_1088648 Ga0373937_1088648_44_583 170
50 3300039438 Ga0436360_0400802 Ga0436360_0400802_1795_2307 170
51 3300045051 Ga0451576_0038608 Ga0451576_0038608_329_850 170
52 3300046461 Ga0495641_0307770 Ga0495641_0307770_161_685 170
53 3300050507 nmdc:mga05p37_121090_c1 nmdc:mga05p37_121090_c1_1364_1885 170
54 3300050507 nmdc:mga05p37_289421_c1 nmdc:mga05p37_289421_c1_171_692 170
55 3300050512 nmdc:mga0n895_298166_c1 nmdc:mga0n895_298166_c1_283_804 170
56 3300060353 Ga0501082_1047056 Ga0501082_1047056_152_667 170
57 3300009093 Ga0105240_10042586 Ga0105240_100425863 171
58 3300013104 Ga0157370_10403184 Ga0157370_104031842 171
59 3300025913 Ga0207695_10031956 Ga0207695_100319566 171
60 3300031852 Ga0307410_10756825 Ga0307410_107568251 171
61 3300032005 Ga0307411_10960540 Ga0307411_109605401 171
62 3300042876 Ga0451577_0000063 Ga0451577_0000063_129762_130277 171
63 3300042876 Ga0451577_0935944 Ga0451577_0935944_83_598 171
64 3300044673 Ga0453683_0004676 Ga0453683_0004676_7387_7902 171
65 3300044673 Ga0453683_0050442 Ga0453683_0050442_1357_1872 171
66 3300044712 Ga0453684_0000198 Ga0453684_0000198_134103_134618 171
67 3300045051 Ga0451576_0002685 Ga0451576_0002685_9957_10472 171
68 3300045051 Ga0451576_0024078 Ga0451576_0024078_4125_4640 171
69 3300021384 Ga0213876_10358461 Ga0213876_103584611 172
70 3300039437 Ga0436365_1484898 Ga0436365_1484898_419_937 172
71 3300044673 Ga0453683_0444587 Ga0453683_0444587_256_774 172
72 3300045051 Ga0451576_0039524 Ga0451576_0039524_2195_2713 172
73 3300046459 Ga0495629_0164290 Ga0495629_0164290_45_572 172
74 3300046683 Ga0495658_0321476 Ga0495658_0321476_251_778 172
75 3300005841 Ga0068863_100229016 Ga0068863_1002290162 173
76 3300013297 Ga0157378_10199441 Ga0157378_101994412 173
77 3300025941 Ga0207711_10131321 Ga0207711_101313212 173
78 3300026035 Ga0207703_11062695 Ga0207703_110626951 173
79 3300028800 Ga0265338_10024603 Ga0265338_100246034 173
80 3300031240 Ga0265320_10062091 Ga0265320_100620912 173
81 3300031616 Ga0307508_10027690 Ga0307508_100276907 173
82 3300005445 Ga0070708_100082986 Ga0070708_1000829863 174
83 3300005458 Ga0070681_10227452 Ga0070681_102274522 174
84 3300006847 Ga0075431_100232807 Ga0075431_1002328073 174
85 3300006847 Ga0075431_101292622 Ga0075431_1012926222 174
86 3300006852 Ga0075433_10225623 Ga0075433_102256232 174
87 3300006871 Ga0075434_100401783 Ga0075434_1004017832 174
88 3300006914 Ga0075436_100146320 Ga0075436_1001463204 174
89 3300025912 Ga0207707_10159079 Ga0207707_101590793 174
90 3300050510 nmdc:mga06r32_1175216_c1 nmdc:mga06r32_1175216_c1_106_633 174
91 3300050510 nmdc:mga06r32_165814_c1 nmdc:mga06r32_165814_c1_644_1171 174
92 3300050513 nmdc:mga0rr50_231652_c1 nmdc:mga0rr50_231652_c1_919_1446 174
93 3300050514 nmdc:mga08x19_156679_c1 nmdc:mga08x19_156679_c1_14_541 174
94 3300050515 nmdc:mga0a205_219965_c1 nmdc:mga0a205_219965_c1_201_728 174
95 3300031727 Ga0316576_10000216 Ga0316576_1000021616 175
96 3300031728 Ga0316578_10068812 Ga0316578_100688122 175
97 3300031727 Ga0316576_10302080 Ga0316576_103020801 176
98 3300031728 Ga0316578_10221575 Ga0316578_102215752 176
99 3300036712 Ga0316584_0000162 Ga0316584_0000162_6729_7259 176
100 3300041498 Ga0451841_0875738 Ga0451841_0875738_740_1270 176
101 3300031456 Ga0307513_10307165 Ga0307513_103071652 177
102 3300042876 Ga0451577_0209262 Ga0451577_0209262_418_951 177
103 3300044673 Ga0453683_0040616 Ga0453683_0040616_1854_2387 177
104 3300044673 Ga0453683_0040838 Ga0453683_0040838_1855_2388 177
105 3300044712 Ga0453684_0046009 Ga0453684_0046009_4464_4997 177
106 3300045051 Ga0451576_0226852 Ga0451576_0226852_251_784 177
107 3300050509 nmdc:mga0qj67_102673_c1 nmdc:mga0qj67_102673_c1_1164_1697 177
108 3300031995 Ga0307409_100351204 Ga0307409_1003512042 178
109 3300045051 Ga0451576_0030965 Ga0451576_0030965_1670_2206 178
110 3300046642 Ga0495634_0485806 Ga0495634_0485806_24_560 178
111 3300049583 Ga0501067_0000064 Ga0501067_0000064_47140_47676 178
112 3300049589 Ga0501073_0011997 Ga0501073_0011997_3341_3877 178
113 3300005436 Ga0070713_100175704 Ga0070713_1001757042 179
114 3300006871 Ga0075434_100561670 Ga0075434_1005616702 179
115 3300025928 Ga0207700_10332357 Ga0207700_103323572 179
116 3300026078 Ga0207702_10387678 Ga0207702_103876782 179
117 3300026078 Ga0207702_11059292 Ga0207702_110592922 179
118 3300046477 Ga0495664_0090328 Ga0495664_0090328_671_1210 179
119 3300046514 Ga0495618_0232639 Ga0495618_0232639_135_674 179
120 3300046516 Ga0495628_0518057 Ga0495628_0518057_71_610 179
121 3300046517 Ga0495630_0074409 Ga0495630_0074409_1618_2157 179
122 3300046642 Ga0495634_0001216 Ga0495634_0001216_17853_18392 179
123 3300046678 Ga0495599_0425640 Ga0495599_0425640_14_553 179
124 3300047319 Ga0495674_0015530 Ga0495674_0015530_6380_6919 179
125 3300048917 Ga0496114_0067319 Ga0496114_0067319_50_589 179
126 3300049583 Ga0501067_0431528 Ga0501067_0431528_40_579 179
127 3300049586 Ga0501070_0207690 Ga0501070_0207690_276_815 179
128 3300049589 Ga0501073_0091036 Ga0501073_0091036_173_712 179
129 3300031238 Ga0265332_10140899 Ga0265332_101408992 180
130 3300031240 Ga0265320_10002116 Ga0265320_100021165 180
131 3300031249 Ga0265339_10001693 Ga0265339_1000169316 180
132 3300031712 Ga0265342_10000276 Ga0265342_100002762 180
133 3300048909 Ga0496106_0589365 Ga0496106_0589365_332_874 180
134 3300049583 Ga0501067_0001119 Ga0501067_0001119_1997_2539 180
135 3300049589 Ga0501073_0004074 Ga0501073_0004074_4580_5122 180
136 3300005340 Ga0070689_100089930 Ga0070689_1000899302 181
137 3300005364 Ga0070673_100016952 Ga0070673_1000169524 181
138 3300005365 Ga0070688_100611093 Ga0070688_1006110931 181
139 3300005438 Ga0070701_10385822 Ga0070701_103858222 181
140 3300005466 Ga0070685_10234032 Ga0070685_102340322 181
141 3300005544 Ga0070686_100015693 Ga0070686_1000156933 181
142 3300006844 Ga0075428_100192827 Ga0075428_1001928272 181
143 3300006847 Ga0075431_100067680 Ga0075431_1000676802 181
144 3300009147 Ga0114129_10262966 Ga0114129_102629662 181
145 3300014969 Ga0157376_10092335 Ga0157376_100923352 181
146 3300025918 Ga0207662_10012290 Ga0207662_100122904 181
147 3300026023 Ga0207677_10165365 Ga0207677_101653652 181
148 3300031238 Ga0265332_10011288 Ga0265332_100112885 181
149 3300031240 Ga0265320_10000470 Ga0265320_1000047010 181
150 3300031241 Ga0265325_10226290 Ga0265325_102262902 181
151 3300031249 Ga0265339_10062049 Ga0265339_100620492 181
152 3300031595 Ga0265313_10081853 Ga0265313_100818531 181
153 3300031712 Ga0265342_10102134 Ga0265342_101021342 181
154 3300035170 Ga0373943_0026872 Ga0373943_0026872_1679_2224 181
155 3300035725 Ga0373947_0037301 Ga0373947_0037301_498_1043 181
156 3300048917 Ga0496114_0027172 Ga0496114_0027172_1740_2294 181
157 3300049571 Ga0501034_0765133 Ga0501034_0765133_260_841 181
158 3300050507 nmdc:mga05p37_474210_c1 nmdc:mga05p37_474210_c1_724_1275 181
159 3300050508 nmdc:mga09592_402966_c1 nmdc:mga09592_402966_c1_189_740 181
160 3300050508 nmdc:mga09592_98998_c1 nmdc:mga09592_98998_c1_1736_2287 181
161 3300054114 Ga0501084_0106821 Ga0501084_0106821_1365_1910 181

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

67

199

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lza-assembly1.cif.gz_B crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700. 0.9841 11 181
4lza-assembly1.cif.gz_A crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700. 0.9804 12 181
4lza-assembly1.cif.gz_B crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700. 0.9729 11 181
6fd6-assembly1.cif.gz_B crystal structure of human aprt-tyr105phe variant in complex with adenine, prpp and mg2+, 30 days post crystallization (with amp and ppi products fully generated) 0.9676 8 181
4lza-assembly1.cif.gz_A crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700. 0.9632 12 181
ID Description Score Start End Superfamily
af_P12426_6_182_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.966 7 181 3.40.50.2020
af_A0A0P0WCD3_31_176_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9625 10 144 3.40.50.2020
af_P9WQ07_33_212_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9622 10 181 3.40.50.2020
af_P91455_5_184_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9615 7 181 3.40.50.2020
6fd5B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9583 10 181 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A7J4CZX2-F1-model_v4 adenine phosphoribosyltransferase (EC 2.4.2.7) 0.9965 64 181 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209
AF-A0A2V6D3R0-F1-model_v4 adenine phosphoribosyltransferase (EC 2.4.2.7) 0.996 73 181 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209
AF-A0A1W9V007-F1-model_v4 Adenine phosphoribosyltransferase (APRT) (EC 2.4.2.7) 0.9946 23 181 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209
AF-A0A2V6FGN4-F1-model_v4 adenine phosphoribosyltransferase (EC 2.4.2.7) 0.9945 89 181 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209
AF-A0A7J8Q206-F1-model_v4 adenine phosphoribosyltransferase (EC 2.4.2.7) 0.9945 89 181 GO:0003999
GO:0005829
GO:0006166

Feature Viewer

pLDDT pTM Quality
94.38 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map