F237280
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 161 | 112 | 161 | 176 |
Family's Representative Sequence
| Representative Sequence | 3300031238|Ga0265332_10011288|Ga0265332_100112885 |
| Length | 212 |
| Sequence | MGSRKRSSHSAKPALPARRAPTPRGVAQTKPPSATEPRDSMAYVRHLVRDIPDFPKSGILFRDITPLLADPRGFHITLDAIAERFVGEHADAIVAVESRGFIFGGALAARLNASFVPVRKPGKLPATTDRVKYSLEYGEGELEMHEDALPSGARVIVMDDLLATGGTAAAAGELVRRQDAIVIAYAFVLELEFLGGRARLAPTPVESLIRYA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 2 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 5 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 6 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 20 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 21 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 22 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 23 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 24 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 25 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 26 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 27 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 28 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 29 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 30 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 31 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 32 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 47 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 63 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 64 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 65 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 66 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 67 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 68 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 69 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 70 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 71 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 72 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 73 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 74 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 75 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 76 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 77 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 78 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 79 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 80 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 81 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 82 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 83 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 84 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 85 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 86 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 87 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 98 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 99 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 100 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 101 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 102 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 103 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 104 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 105 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 106 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 107 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 108 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 109 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 110 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 111 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 112 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.86 |
| Rhizosphere | 95.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070689_100089930 | 3300005340 | Bacteria | 2418 |
| 2 | Ga0070673_100016952 | 3300005364 | Bacteria | 5167 |
| 3 | Ga0070688_100053534 | 3300005365 | Unclassified | 2525 |
| 4 | Ga0070688_100611093 | 3300005365 | Bacteria | 835 |
| 5 | Ga0070713_100175704 | 3300005436 | Bacteria | 1922 |
| 6 | Ga0070701_10385822 | 3300005438 | Bacteria | 884 |
| 7 | Ga0070705_100015021 | 3300005440 | Bacteria | 3995 |
| 8 | Ga0070700_100120578 | 3300005441 | Unclassified | 1757 |
| 9 | Ga0070694_100114488 | 3300005444 | Bacteria | 1926 |
| 10 | Ga0070708_100082986 | 3300005445 | Bacteria | 2904 |
| 11 | Ga0070681_10227452 | 3300005458 | Bacteria | 1780 |
| 12 | Ga0070685_10234032 | 3300005466 | Bacteria | 1210 |
| 13 | Ga0070706_100333754 | 3300005467 | Bacteria | 1414 |
| 14 | Ga0070706_100660057 | 3300005467 | Bacteria | 971 |
| 15 | Ga0070697_100594702 | 3300005536 | Bacteria | 972 |
| 16 | Ga0070686_100015693 | 3300005544 | Bacteria | 4394 |
| 17 | Ga0070695_101053849 | 3300005545 | Bacteria | 663 |
| 18 | Ga0070696_100017129 | 3300005546 | Bacteria | 4890 |
| 19 | Ga0070665_101247118 | 3300005548 | Bacteria | 754 |
| 20 | Ga0070704_100000762 | 3300005549 | Bacteria | 15854 |
| 21 | Ga0070704_100054432 | 3300005549 | Bacteria | 2831 |
| 22 | Ga0070704_100115143 | 3300005549 | Unclassified | 2054 |
| 23 | Ga0068859_101308552 | 3300005617 | Bacteria | 799 |
| 24 | Ga0068864_100791060 | 3300005618 | Unclassified | 932 |
| 25 | Ga0068861_100880347 | 3300005719 | Unclassified | 847 |
| 26 | Ga0068863_100229016 | 3300005841 | Bacteria | 1792 |
| 27 | Ga0068860_100128003 | 3300005843 | Unclassified | 2435 |
| 28 | Ga0068862_101036367 | 3300005844 | Unclassified | 813 |
| 29 | Ga0081539_10001205 | 3300005985 | Bacteria | 46620 |
| 30 | Ga0075428_100018689 | 3300006844 | Bacteria | 7662 |
| 31 | Ga0075428_100192827 | 3300006844 | Bacteria | 2204 |
| 32 | Ga0075428_101876994 | 3300006844 | Unclassified | 623 |
| 33 | Ga0075431_100067680 | 3300006847 | Bacteria | 3687 |
| 34 | Ga0075431_100232807 | 3300006847 | Bacteria | 1876 |
| 35 | Ga0075431_100328907 | 3300006847 | Bacteria | 1540 |
| 36 | Ga0075431_101292622 | 3300006847 | Bacteria | 691 |
| 37 | Ga0075433_10225623 | 3300006852 | Bacteria | 1664 |
| 38 | Ga0075434_100348862 | 3300006871 | Bacteria | 1501 |
| 39 | Ga0075434_100401783 | 3300006871 | Bacteria | 1391 |
| 40 | Ga0075434_100561670 | 3300006871 | Bacteria | 1161 |
| 41 | Ga0075429_100011174 | 3300006880 | Bacteria | 7772 |
| 42 | Ga0075429_100186545 | 3300006880 | Bacteria | 1817 |
| 43 | Ga0075429_100644435 | 3300006880 | Bacteria | 928 |
| 44 | Ga0075436_100146320 | 3300006914 | Bacteria | 1662 |
| 45 | Ga0097620_101308223 | 3300006931 | Bacteria | 799 |
| 46 | Ga0105240_10042586 | 3300009093 | Bacteria | 5785 |
| 47 | Ga0111539_10733579 | 3300009094 | Unclassified | 1150 |
| 48 | Ga0105247_10052291 | 3300009101 | Unclassified | 2518 |
| 49 | Ga0114129_10064271 | 3300009147 | Bacteria | 5121 |
| 50 | Ga0114129_10262966 | 3300009147 | Bacteria | 2311 |
| 51 | Ga0114129_10457465 | 3300009147 | Bacteria | 1673 |
| 52 | Ga0105249_10325835 | 3300009553 | Unclassified | 1548 |
| 53 | Ga0105246_11362963 | 3300011119 | Unclassified | 660 |
| 54 | Ga0157370_10403184 | 3300013104 | Bacteria | 1259 |
| 55 | Ga0157378_10199441 | 3300013297 | Bacteria | 1892 |
| 56 | Ga0163163_10222081 | 3300014325 | Unclassified | 1938 |
| 57 | Ga0157380_10122125 | 3300014326 | Bacteria | 2208 |
| 58 | Ga0157379_11288237 | 3300014968 | Unclassified | 705 |
| 59 | Ga0157376_10092335 | 3300014969 | Bacteria | 2624 |
| 60 | Ga0163161_10187802 | 3300017792 | Unclassified | 1587 |
| 61 | Ga0213876_10358461 | 3300021384 | Bacteria | 776 |
| 62 | Ga0207688_10165958 | 3300025901 | Bacteria | 1311 |
| 63 | Ga0207684_10111886 | 3300025910 | Bacteria | 2337 |
| 64 | Ga0207707_10159079 | 3300025912 | Bacteria | 1975 |
| 65 | Ga0207695_10031956 | 3300025913 | Bacteria | 5765 |
| 66 | Ga0207662_10012290 | 3300025918 | Bacteria | 4765 |
| 67 | Ga0207646_10481594 | 3300025922 | Bacteria | 1119 |
| 68 | Ga0207700_10332357 | 3300025928 | Bacteria | 1319 |
| 69 | Ga0207711_10131321 | 3300025941 | Bacteria | 2246 |
| 70 | Ga0207712_10171162 | 3300025961 | Unclassified | 1698 |
| 71 | Ga0207677_10165365 | 3300026023 | Bacteria | 1724 |
| 72 | Ga0207703_11062695 | 3300026035 | Bacteria | 777 |
| 73 | Ga0207708_10115548 | 3300026075 | Unclassified | 2087 |
| 74 | Ga0207702_10387678 | 3300026078 | Bacteria | 1345 |
| 75 | Ga0207702_11059292 | 3300026078 | Bacteria | 805 |
| 76 | Ga0207676_10464300 | 3300026095 | Unclassified | 1196 |
| 77 | Ga0207675_100116392 | 3300026118 | Bacteria | 2526 |
| 78 | Ga0265338_10024603 | 3300028800 | Bacteria | 6145 |
| 79 | Ga0265332_10011288 | 3300031238 | Bacteria | 3972 |
| 80 | Ga0265332_10140899 | 3300031238 | Bacteria | 1010 |
| 81 | Ga0265320_10000470 | 3300031240 | Bacteria | 31538 |
| 82 | Ga0265320_10002116 | 3300031240 | Bacteria | 13961 |
| 83 | Ga0265320_10062091 | 3300031240 | Unclassified | 1780 |
| 84 | Ga0265325_10226290 | 3300031241 | Unclassified | 854 |
| 85 | Ga0265339_10001693 | 3300031249 | Bacteria | 16264 |
| 86 | Ga0265339_10062049 | 3300031249 | Bacteria | 2010 |
| 87 | Ga0307513_10307165 | 3300031456 | Bacteria | 1350 |
| 88 | Ga0265313_10081853 | 3300031595 | Unclassified | 1465 |
| 89 | Ga0307508_10027690 | 3300031616 | Bacteria | 5129 |
| 90 | Ga0265342_10000276 | 3300031712 | Bacteria | 57738 |
| 91 | Ga0265342_10102134 | 3300031712 | Bacteria | 1632 |
| 92 | Ga0316576_10000216 | 3300031727 | Bacteria | 24373 |
| 93 | Ga0316576_10302080 | 3300031727 | Bacteria | 1196 |
| 94 | Ga0316578_10068812 | 3300031728 | Bacteria | 2094 |
| 95 | Ga0316578_10221575 | 3300031728 | Bacteria | 1137 |
| 96 | Ga0307410_10756825 | 3300031852 | Bacteria | 823 |
| 97 | Ga0307409_100351204 | 3300031995 | Bacteria | 1391 |
| 98 | Ga0307411_10960540 | 3300032005 | Bacteria | 763 |
| 99 | Ga0373943_0026872 | 3300035170 | Bacteria | 2700 |
| 100 | Ga0373947_0037301 | 3300035725 | Bacteria | 2884 |
| 101 | Ga0373937_1088648 | 3300036401 | Bacteria | 748 |
| 102 | Ga0316584_0000162 | 3300036712 | Bacteria | 31170 |
| 103 | Ga0436365_1484898 | 3300039437 | Bacteria | 1765 |
| 104 | Ga0436360_0400802 | 3300039438 | Bacteria | 2519 |
| 105 | Ga0451841_0875738 | 3300041498 | Bacteria | 1282 |
| 106 | Ga0451577_0000063 | 3300042876 | Bacteria | 264379 |
| 107 | Ga0451577_0209262 | 3300042876 | Bacteria | 1762 |
| 108 | Ga0451577_0935944 | 3300042876 | Bacteria | 779 |
| 109 | Ga0453683_0004676 | 3300044673 | Bacteria | 9660 |
| 110 | Ga0453683_0040616 | 3300044673 | Bacteria | 2920 |
| 111 | Ga0453683_0040838 | 3300044673 | Bacteria | 2912 |
| 112 | Ga0453683_0050442 | 3300044673 | Bacteria | 2607 |
| 113 | Ga0453683_0444587 | 3300044673 | Bacteria | 838 |
| 114 | Ga0453684_0000198 | 3300044712 | Bacteria | 264379 |
| 115 | Ga0453684_0046009 | 3300044712 | Bacteria | 5812 |
| 116 | Ga0451576_0002685 | 3300045051 | Bacteria | 25909 |
| 117 | Ga0451576_0024078 | 3300045051 | Bacteria | 6579 |
| 118 | Ga0451576_0030965 | 3300045051 | Bacteria | 5708 |
| 119 | Ga0451576_0038608 | 3300045051 | Bacteria | 5053 |
| 120 | Ga0451576_0039524 | 3300045051 | Bacteria | 4993 |
| 121 | Ga0451576_0226852 | 3300045051 | Bacteria | 1950 |
| 122 | Ga0495629_0164290 | 3300046459 | Bacteria | 1542 |
| 123 | Ga0495641_0307770 | 3300046461 | Unclassified | 714 |
| 124 | Ga0495664_0090328 | 3300046477 | Bacteria | 1841 |
| 125 | Ga0495618_0232639 | 3300046514 | Bacteria | 1160 |
| 126 | Ga0495628_0518057 | 3300046516 | Bacteria | 859 |
| 127 | Ga0495630_0074409 | 3300046517 | Bacteria | 2558 |
| 128 | Ga0495634_0001216 | 3300046642 | Bacteria | 23760 |
| 129 | Ga0495634_0485806 | 3300046642 | Bacteria | 725 |
| 130 | Ga0495599_0425640 | 3300046678 | Bacteria | 788 |
| 131 | Ga0495658_0321476 | 3300046683 | Bacteria | 981 |
| 132 | Ga0495674_0015530 | 3300047319 | Bacteria | 7115 |
| 133 | Ga0496106_0589365 | 3300048909 | Bacteria | 891 |
| 134 | Ga0496114_0027172 | 3300048917 | Bacteria | 4686 |
| 135 | Ga0496114_0067319 | 3300048917 | Bacteria | 3004 |
| 136 | Ga0501034_0765133 | 3300049571 | Bacteria | 860 |
| 137 | Ga0501067_0000064 | 3300049583 | Bacteria | 60217 |
| 138 | Ga0501067_0001119 | 3300049583 | Bacteria | 14517 |
| 139 | Ga0501067_0431528 | 3300049583 | Bacteria | 735 |
| 140 | Ga0501070_0207690 | 3300049586 | Bacteria | 1608 |
| 141 | Ga0501073_0004074 | 3300049589 | Bacteria | 10964 |
| 142 | Ga0501073_0011997 | 3300049589 | Bacteria | 6327 |
| 143 | Ga0501073_0091036 | 3300049589 | Bacteria | 2120 |
| 144 | nmdc:mga05p37_121090_c1 | 3300050507 | Bacteria | 3214 |
| 145 | nmdc:mga05p37_229674_c1 | 3300050507 | Bacteria | 2236 |
| 146 | nmdc:mga05p37_289421_c1 | 3300050507 | Unclassified | 1950 |
| 147 | nmdc:mga05p37_474210_c1 | 3300050507 | Bacteria | 1443 |
| 148 | nmdc:mga09592_11849_c1 | 3300050508 | Bacteria | 7093 |
| 149 | nmdc:mga09592_402966_c1 | 3300050508 | Bacteria | 1182 |
| 150 | nmdc:mga09592_98234_c1 | 3300050508 | Bacteria | 2506 |
| 151 | nmdc:mga09592_98998_c1 | 3300050508 | Bacteria | 2496 |
| 152 | nmdc:mga0qj67_102673_c1 | 3300050509 | Bacteria | 2306 |
| 153 | nmdc:mga06r32_1175216_c1 | 3300050510 | Bacteria | 714 |
| 154 | nmdc:mga06r32_165814_c1 | 3300050510 | Bacteria | 2192 |
| 155 | nmdc:mga06r32_712358_c1 | 3300050510 | Bacteria | 969 |
| 156 | nmdc:mga0n895_298166_c1 | 3300050512 | Bacteria | 1634 |
| 157 | nmdc:mga0rr50_231652_c1 | 3300050513 | Bacteria | 1528 |
| 158 | nmdc:mga08x19_156679_c1 | 3300050514 | Bacteria | 1545 |
| 159 | nmdc:mga0a205_219965_c1 | 3300050515 | Bacteria | 1785 |
| 160 | Ga0501084_0106821 | 3300054114 | Bacteria | 2352 |
| 161 | Ga0501082_1047056 | 3300060353 | Bacteria | 713 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006880 | Ga0075429_100644435 | Ga0075429_1006444352 | 148 |
| 2 | 3300005440 | Ga0070705_100015021 | Ga0070705_1000150214 | 169 |
| 3 | 3300005444 | Ga0070694_100114488 | Ga0070694_1001144882 | 169 |
| 4 | 3300005467 | Ga0070706_100660057 | Ga0070706_1006600573 | 169 |
| 5 | 3300005545 | Ga0070695_101053849 | Ga0070695_1010538491 | 169 |
| 6 | 3300005546 | Ga0070696_100017129 | Ga0070696_1000171294 | 169 |
| 7 | 3300005549 | Ga0070704_100000762 | Ga0070704_1000007625 | 169 |
| 8 | 3300005549 | Ga0070704_100054432 | Ga0070704_1000544324 | 169 |
| 9 | 3300006844 | Ga0075428_100018689 | Ga0075428_10001868911 | 169 |
| 10 | 3300006847 | Ga0075431_100328907 | Ga0075431_1003289072 | 169 |
| 11 | 3300006880 | Ga0075429_100011174 | Ga0075429_1000111745 | 169 |
| 12 | 3300006880 | Ga0075429_100186545 | Ga0075429_1001865452 | 169 |
| 13 | 3300050507 | nmdc:mga05p37_229674_c1 | nmdc:mga05p37_229674_c1_1535_2065 | 169 |
| 14 | 3300050508 | nmdc:mga09592_11849_c1 | nmdc:mga09592_11849_c1_1622_2152 | 169 |
| 15 | 3300050508 | nmdc:mga09592_98234_c1 | nmdc:mga09592_98234_c1_561_1091 | 169 |
| 16 | 3300050510 | nmdc:mga06r32_712358_c1 | nmdc:mga06r32_712358_c1_316_846 | 169 |
| 17 | 3300005365 | Ga0070688_100053534 | Ga0070688_1000535342 | 170 |
| 18 | 3300005441 | Ga0070700_100120578 | Ga0070700_1001205782 | 170 |
| 19 | 3300005467 | Ga0070706_100333754 | Ga0070706_1003337542 | 170 |
| 20 | 3300005536 | Ga0070697_100594702 | Ga0070697_1005947022 | 170 |
| 21 | 3300005548 | Ga0070665_101247118 | Ga0070665_1012471182 | 170 |
| 22 | 3300005549 | Ga0070704_100115143 | Ga0070704_1001151433 | 170 |
| 23 | 3300005617 | Ga0068859_101308552 | Ga0068859_1013085522 | 170 |
| 24 | 3300005618 | Ga0068864_100791060 | Ga0068864_1007910602 | 170 |
| 25 | 3300005719 | Ga0068861_100880347 | Ga0068861_1008803472 | 170 |
| 26 | 3300005843 | Ga0068860_100128003 | Ga0068860_1001280034 | 170 |
| 27 | 3300005844 | Ga0068862_101036367 | Ga0068862_1010363672 | 170 |
| 28 | 3300005985 | Ga0081539_10001205 | Ga0081539_1000120526 | 170 |
| 29 | 3300006844 | Ga0075428_101876994 | Ga0075428_1018769941 | 170 |
| 30 | 3300006871 | Ga0075434_100348862 | Ga0075434_1003488622 | 170 |
| 31 | 3300006931 | Ga0097620_101308223 | Ga0097620_1013082232 | 170 |
| 32 | 3300009094 | Ga0111539_10733579 | Ga0111539_107335792 | 170 |
| 33 | 3300009101 | Ga0105247_10052291 | Ga0105247_100522913 | 170 |
| 34 | 3300009147 | Ga0114129_10064271 | Ga0114129_100642713 | 170 |
| 35 | 3300009147 | Ga0114129_10457465 | Ga0114129_104574652 | 170 |
| 36 | 3300009553 | Ga0105249_10325835 | Ga0105249_103258353 | 170 |
| 37 | 3300011119 | Ga0105246_11362963 | Ga0105246_113629632 | 170 |
| 38 | 3300014325 | Ga0163163_10222081 | Ga0163163_102220813 | 170 |
| 39 | 3300014326 | Ga0157380_10122125 | Ga0157380_101221251 | 170 |
| 40 | 3300014968 | Ga0157379_11288237 | Ga0157379_112882372 | 170 |
| 41 | 3300017792 | Ga0163161_10187802 | Ga0163161_101878022 | 170 |
| 42 | 3300025901 | Ga0207688_10165958 | Ga0207688_101659582 | 170 |
| 43 | 3300025910 | Ga0207684_10111886 | Ga0207684_101118862 | 170 |
| 44 | 3300025922 | Ga0207646_10481594 | Ga0207646_104815941 | 170 |
| 45 | 3300025961 | Ga0207712_10171162 | Ga0207712_101711622 | 170 |
| 46 | 3300026075 | Ga0207708_10115548 | Ga0207708_101155481 | 170 |
| 47 | 3300026095 | Ga0207676_10464300 | Ga0207676_104643002 | 170 |
| 48 | 3300026118 | Ga0207675_100116392 | Ga0207675_1001163922 | 170 |
| 49 | 3300036401 | Ga0373937_1088648 | Ga0373937_1088648_44_583 | 170 |
| 50 | 3300039438 | Ga0436360_0400802 | Ga0436360_0400802_1795_2307 | 170 |
| 51 | 3300045051 | Ga0451576_0038608 | Ga0451576_0038608_329_850 | 170 |
| 52 | 3300046461 | Ga0495641_0307770 | Ga0495641_0307770_161_685 | 170 |
| 53 | 3300050507 | nmdc:mga05p37_121090_c1 | nmdc:mga05p37_121090_c1_1364_1885 | 170 |
| 54 | 3300050507 | nmdc:mga05p37_289421_c1 | nmdc:mga05p37_289421_c1_171_692 | 170 |
| 55 | 3300050512 | nmdc:mga0n895_298166_c1 | nmdc:mga0n895_298166_c1_283_804 | 170 |
| 56 | 3300060353 | Ga0501082_1047056 | Ga0501082_1047056_152_667 | 170 |
| 57 | 3300009093 | Ga0105240_10042586 | Ga0105240_100425863 | 171 |
| 58 | 3300013104 | Ga0157370_10403184 | Ga0157370_104031842 | 171 |
| 59 | 3300025913 | Ga0207695_10031956 | Ga0207695_100319566 | 171 |
| 60 | 3300031852 | Ga0307410_10756825 | Ga0307410_107568251 | 171 |
| 61 | 3300032005 | Ga0307411_10960540 | Ga0307411_109605401 | 171 |
| 62 | 3300042876 | Ga0451577_0000063 | Ga0451577_0000063_129762_130277 | 171 |
| 63 | 3300042876 | Ga0451577_0935944 | Ga0451577_0935944_83_598 | 171 |
| 64 | 3300044673 | Ga0453683_0004676 | Ga0453683_0004676_7387_7902 | 171 |
| 65 | 3300044673 | Ga0453683_0050442 | Ga0453683_0050442_1357_1872 | 171 |
| 66 | 3300044712 | Ga0453684_0000198 | Ga0453684_0000198_134103_134618 | 171 |
| 67 | 3300045051 | Ga0451576_0002685 | Ga0451576_0002685_9957_10472 | 171 |
| 68 | 3300045051 | Ga0451576_0024078 | Ga0451576_0024078_4125_4640 | 171 |
| 69 | 3300021384 | Ga0213876_10358461 | Ga0213876_103584611 | 172 |
| 70 | 3300039437 | Ga0436365_1484898 | Ga0436365_1484898_419_937 | 172 |
| 71 | 3300044673 | Ga0453683_0444587 | Ga0453683_0444587_256_774 | 172 |
| 72 | 3300045051 | Ga0451576_0039524 | Ga0451576_0039524_2195_2713 | 172 |
| 73 | 3300046459 | Ga0495629_0164290 | Ga0495629_0164290_45_572 | 172 |
| 74 | 3300046683 | Ga0495658_0321476 | Ga0495658_0321476_251_778 | 172 |
| 75 | 3300005841 | Ga0068863_100229016 | Ga0068863_1002290162 | 173 |
| 76 | 3300013297 | Ga0157378_10199441 | Ga0157378_101994412 | 173 |
| 77 | 3300025941 | Ga0207711_10131321 | Ga0207711_101313212 | 173 |
| 78 | 3300026035 | Ga0207703_11062695 | Ga0207703_110626951 | 173 |
| 79 | 3300028800 | Ga0265338_10024603 | Ga0265338_100246034 | 173 |
| 80 | 3300031240 | Ga0265320_10062091 | Ga0265320_100620912 | 173 |
| 81 | 3300031616 | Ga0307508_10027690 | Ga0307508_100276907 | 173 |
| 82 | 3300005445 | Ga0070708_100082986 | Ga0070708_1000829863 | 174 |
| 83 | 3300005458 | Ga0070681_10227452 | Ga0070681_102274522 | 174 |
| 84 | 3300006847 | Ga0075431_100232807 | Ga0075431_1002328073 | 174 |
| 85 | 3300006847 | Ga0075431_101292622 | Ga0075431_1012926222 | 174 |
| 86 | 3300006852 | Ga0075433_10225623 | Ga0075433_102256232 | 174 |
| 87 | 3300006871 | Ga0075434_100401783 | Ga0075434_1004017832 | 174 |
| 88 | 3300006914 | Ga0075436_100146320 | Ga0075436_1001463204 | 174 |
| 89 | 3300025912 | Ga0207707_10159079 | Ga0207707_101590793 | 174 |
| 90 | 3300050510 | nmdc:mga06r32_1175216_c1 | nmdc:mga06r32_1175216_c1_106_633 | 174 |
| 91 | 3300050510 | nmdc:mga06r32_165814_c1 | nmdc:mga06r32_165814_c1_644_1171 | 174 |
| 92 | 3300050513 | nmdc:mga0rr50_231652_c1 | nmdc:mga0rr50_231652_c1_919_1446 | 174 |
| 93 | 3300050514 | nmdc:mga08x19_156679_c1 | nmdc:mga08x19_156679_c1_14_541 | 174 |
| 94 | 3300050515 | nmdc:mga0a205_219965_c1 | nmdc:mga0a205_219965_c1_201_728 | 174 |
| 95 | 3300031727 | Ga0316576_10000216 | Ga0316576_1000021616 | 175 |
| 96 | 3300031728 | Ga0316578_10068812 | Ga0316578_100688122 | 175 |
| 97 | 3300031727 | Ga0316576_10302080 | Ga0316576_103020801 | 176 |
| 98 | 3300031728 | Ga0316578_10221575 | Ga0316578_102215752 | 176 |
| 99 | 3300036712 | Ga0316584_0000162 | Ga0316584_0000162_6729_7259 | 176 |
| 100 | 3300041498 | Ga0451841_0875738 | Ga0451841_0875738_740_1270 | 176 |
| 101 | 3300031456 | Ga0307513_10307165 | Ga0307513_103071652 | 177 |
| 102 | 3300042876 | Ga0451577_0209262 | Ga0451577_0209262_418_951 | 177 |
| 103 | 3300044673 | Ga0453683_0040616 | Ga0453683_0040616_1854_2387 | 177 |
| 104 | 3300044673 | Ga0453683_0040838 | Ga0453683_0040838_1855_2388 | 177 |
| 105 | 3300044712 | Ga0453684_0046009 | Ga0453684_0046009_4464_4997 | 177 |
| 106 | 3300045051 | Ga0451576_0226852 | Ga0451576_0226852_251_784 | 177 |
| 107 | 3300050509 | nmdc:mga0qj67_102673_c1 | nmdc:mga0qj67_102673_c1_1164_1697 | 177 |
| 108 | 3300031995 | Ga0307409_100351204 | Ga0307409_1003512042 | 178 |
| 109 | 3300045051 | Ga0451576_0030965 | Ga0451576_0030965_1670_2206 | 178 |
| 110 | 3300046642 | Ga0495634_0485806 | Ga0495634_0485806_24_560 | 178 |
| 111 | 3300049583 | Ga0501067_0000064 | Ga0501067_0000064_47140_47676 | 178 |
| 112 | 3300049589 | Ga0501073_0011997 | Ga0501073_0011997_3341_3877 | 178 |
| 113 | 3300005436 | Ga0070713_100175704 | Ga0070713_1001757042 | 179 |
| 114 | 3300006871 | Ga0075434_100561670 | Ga0075434_1005616702 | 179 |
| 115 | 3300025928 | Ga0207700_10332357 | Ga0207700_103323572 | 179 |
| 116 | 3300026078 | Ga0207702_10387678 | Ga0207702_103876782 | 179 |
| 117 | 3300026078 | Ga0207702_11059292 | Ga0207702_110592922 | 179 |
| 118 | 3300046477 | Ga0495664_0090328 | Ga0495664_0090328_671_1210 | 179 |
| 119 | 3300046514 | Ga0495618_0232639 | Ga0495618_0232639_135_674 | 179 |
| 120 | 3300046516 | Ga0495628_0518057 | Ga0495628_0518057_71_610 | 179 |
| 121 | 3300046517 | Ga0495630_0074409 | Ga0495630_0074409_1618_2157 | 179 |
| 122 | 3300046642 | Ga0495634_0001216 | Ga0495634_0001216_17853_18392 | 179 |
| 123 | 3300046678 | Ga0495599_0425640 | Ga0495599_0425640_14_553 | 179 |
| 124 | 3300047319 | Ga0495674_0015530 | Ga0495674_0015530_6380_6919 | 179 |
| 125 | 3300048917 | Ga0496114_0067319 | Ga0496114_0067319_50_589 | 179 |
| 126 | 3300049583 | Ga0501067_0431528 | Ga0501067_0431528_40_579 | 179 |
| 127 | 3300049586 | Ga0501070_0207690 | Ga0501070_0207690_276_815 | 179 |
| 128 | 3300049589 | Ga0501073_0091036 | Ga0501073_0091036_173_712 | 179 |
| 129 | 3300031238 | Ga0265332_10140899 | Ga0265332_101408992 | 180 |
| 130 | 3300031240 | Ga0265320_10002116 | Ga0265320_100021165 | 180 |
| 131 | 3300031249 | Ga0265339_10001693 | Ga0265339_1000169316 | 180 |
| 132 | 3300031712 | Ga0265342_10000276 | Ga0265342_100002762 | 180 |
| 133 | 3300048909 | Ga0496106_0589365 | Ga0496106_0589365_332_874 | 180 |
| 134 | 3300049583 | Ga0501067_0001119 | Ga0501067_0001119_1997_2539 | 180 |
| 135 | 3300049589 | Ga0501073_0004074 | Ga0501073_0004074_4580_5122 | 180 |
| 136 | 3300005340 | Ga0070689_100089930 | Ga0070689_1000899302 | 181 |
| 137 | 3300005364 | Ga0070673_100016952 | Ga0070673_1000169524 | 181 |
| 138 | 3300005365 | Ga0070688_100611093 | Ga0070688_1006110931 | 181 |
| 139 | 3300005438 | Ga0070701_10385822 | Ga0070701_103858222 | 181 |
| 140 | 3300005466 | Ga0070685_10234032 | Ga0070685_102340322 | 181 |
| 141 | 3300005544 | Ga0070686_100015693 | Ga0070686_1000156933 | 181 |
| 142 | 3300006844 | Ga0075428_100192827 | Ga0075428_1001928272 | 181 |
| 143 | 3300006847 | Ga0075431_100067680 | Ga0075431_1000676802 | 181 |
| 144 | 3300009147 | Ga0114129_10262966 | Ga0114129_102629662 | 181 |
| 145 | 3300014969 | Ga0157376_10092335 | Ga0157376_100923352 | 181 |
| 146 | 3300025918 | Ga0207662_10012290 | Ga0207662_100122904 | 181 |
| 147 | 3300026023 | Ga0207677_10165365 | Ga0207677_101653652 | 181 |
| 148 | 3300031238 | Ga0265332_10011288 | Ga0265332_100112885 | 181 |
| 149 | 3300031240 | Ga0265320_10000470 | Ga0265320_1000047010 | 181 |
| 150 | 3300031241 | Ga0265325_10226290 | Ga0265325_102262902 | 181 |
| 151 | 3300031249 | Ga0265339_10062049 | Ga0265339_100620492 | 181 |
| 152 | 3300031595 | Ga0265313_10081853 | Ga0265313_100818531 | 181 |
| 153 | 3300031712 | Ga0265342_10102134 | Ga0265342_101021342 | 181 |
| 154 | 3300035170 | Ga0373943_0026872 | Ga0373943_0026872_1679_2224 | 181 |
| 155 | 3300035725 | Ga0373947_0037301 | Ga0373947_0037301_498_1043 | 181 |
| 156 | 3300048917 | Ga0496114_0027172 | Ga0496114_0027172_1740_2294 | 181 |
| 157 | 3300049571 | Ga0501034_0765133 | Ga0501034_0765133_260_841 | 181 |
| 158 | 3300050507 | nmdc:mga05p37_474210_c1 | nmdc:mga05p37_474210_c1_724_1275 | 181 |
| 159 | 3300050508 | nmdc:mga09592_402966_c1 | nmdc:mga09592_402966_c1_189_740 | 181 |
| 160 | 3300050508 | nmdc:mga09592_98998_c1 | nmdc:mga09592_98998_c1_1736_2287 | 181 |
| 161 | 3300054114 | Ga0501084_0106821 | Ga0501084_0106821_1365_1910 | 181 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4lza-assembly1.cif.gz_B | crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700. | 0.9841 | 11 | 181 |
| 4lza-assembly1.cif.gz_A | crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700. | 0.9804 | 12 | 181 |
| 4lza-assembly1.cif.gz_B | crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700. | 0.9729 | 11 | 181 |
| 6fd6-assembly1.cif.gz_B | crystal structure of human aprt-tyr105phe variant in complex with adenine, prpp and mg2+, 30 days post crystallization (with amp and ppi products fully generated) | 0.9676 | 8 | 181 |
| 4lza-assembly1.cif.gz_A | crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700. | 0.9632 | 12 | 181 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P12426_6_182_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.966 | 7 | 181 | 3.40.50.2020 |
| af_A0A0P0WCD3_31_176_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9625 | 10 | 144 | 3.40.50.2020 |
| af_P9WQ07_33_212_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9622 | 10 | 181 | 3.40.50.2020 |
| af_P91455_5_184_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9615 | 7 | 181 | 3.40.50.2020 |
| 6fd5B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9583 | 10 | 181 | 3.40.50.2020 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7J4CZX2-F1-model_v4 | adenine phosphoribosyltransferase (EC 2.4.2.7) | 0.9965 | 64 | 181 |
GO:0002055
GO:0003999 GO:0005737 GO:0006166 GO:0006168 GO:0016208 GO:0044209 |
| AF-A0A2V6D3R0-F1-model_v4 | adenine phosphoribosyltransferase (EC 2.4.2.7) | 0.996 | 73 | 181 |
GO:0002055
GO:0003999 GO:0005737 GO:0006166 GO:0006168 GO:0016208 GO:0044209 |
| AF-A0A1W9V007-F1-model_v4 | Adenine phosphoribosyltransferase (APRT) (EC 2.4.2.7) | 0.9946 | 23 | 181 |
GO:0002055
GO:0003999 GO:0005737 GO:0006166 GO:0006168 GO:0016208 GO:0044209 |
| AF-A0A2V6FGN4-F1-model_v4 | adenine phosphoribosyltransferase (EC 2.4.2.7) | 0.9945 | 89 | 181 |
GO:0002055
GO:0003999 GO:0005737 GO:0006166 GO:0006168 GO:0016208 GO:0044209 |
| AF-A0A7J8Q206-F1-model_v4 | adenine phosphoribosyltransferase (EC 2.4.2.7) | 0.9945 | 89 | 181 |
GO:0003999
GO:0005829 GO:0006166 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar