F236930

General Info

Members Datasets Scaffolds Average Seq Length
161 106 322 128

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10942673|Ga0105248_109426732
Length 140
Sequence VNRIFLDTSAYSAFKKGHSQLRYRIREASQIQLNPVVLGELRAGFLQGTRLRENLAELAQFLASPRVAVFAVDEETAARYAVIFDPLRRAGTPIPTNDIWIAASAMQCGSVLLTTDPHFRLISQVVVEIFEPHLNRPKQG

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
63 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
66 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
67 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
68 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
69 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
70 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
71 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
72 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
73 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
74 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
75 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
76 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
77 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
80 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
81 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
82 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
83 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
84 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
85 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
86 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
87 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
88 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
89 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
90 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
91 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
93 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
94 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
95 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
96 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
97 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
98 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
99 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
100 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
101 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
102 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
103 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
104 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
105 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
106 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0.62
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 94.41
Stem 0
Stem Tuber 0
Unclassified 39.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10942673 3300009177 Bacteria 975
2 rootL2_10253795 3300003322 Bacteria 1109
3 Ga0070658_11948772 3300005327 Unclassified 507
4 Ga0068868_100747568 3300005338 Unclassified 878
5 Ga0070689_100165788 3300005340 Unclassified 1788
6 Ga0070671_100092004 3300005355 Unclassified 2541
7 Ga0070688_100210707 3300005365 Unclassified 1364
8 Ga0070709_10305455 3300005434 Bacteria 1163
9 Ga0070711_100657264 3300005439 Bacteria 879
10 Ga0070705_100149538 3300005440 Bacteria 1547
11 Ga0070708_101506485 3300005445 Unclassified 627
12 Ga0070681_10146080 3300005458 Bacteria 2294
13 Ga0070707_102117596 3300005468 Unclassified 530
14 Ga0070698_101113946 3300005471 Unclassified 738
15 Ga0070699_100417590 3300005518 Bacteria 1214
16 Ga0070679_100537289 3300005530 Unclassified 1113
17 Ga0070697_100071233 3300005536 Unclassified 2851
18 Ga0070686_100982014 3300005544 Unclassified 692
19 Ga0070665_100019398 3300005548 Bacteria 6823
20 Ga0070704_100511797 3300005549 Bacteria 1043
21 Ga0070704_100713075 3300005549 Bacteria 890
22 Ga0070704_101481778 3300005549 Unclassified 624
23 Ga0068859_100070361 3300005617 Unclassified 3534
24 Ga0068859_100906351 3300005617 Bacteria 966
25 Ga0068863_100439299 3300005841 Bacteria 1279
26 Ga0068863_100456932 3300005841 Unclassified 1254
27 Ga0068858_101131812 3300005842 Unclassified 769
28 Ga0068860_100163452 3300005843 Bacteria 2147
29 Ga0068860_101066494 3300005843 Unclassified 827
30 Ga0070717_11095801 3300006028 Unclassified 725
31 Ga0075432_10016845 3300006058 Bacteria 2495
32 Ga0097621_100210376 3300006237 Bacteria 1692
33 Ga0097621_101392758 3300006237 Unclassified 664
34 Ga0075428_100604477 3300006844 Bacteria 1171
35 Ga0075428_100989168 3300006844 Unclassified 891
36 Ga0075430_100359974 3300006846 Bacteria 1201
37 Ga0075430_100658061 3300006846 Unclassified 864
38 Ga0075431_100345458 3300006847 Bacteria 1497
39 Ga0075433_10038471 3300006852 Bacteria 4132
40 Ga0075433_10081469 3300006852 Unclassified 2854
41 Ga0075433_10320773 3300006852 Bacteria 1371
42 Ga0075434_100000332 3300006871 Bacteria 34006
43 Ga0075434_100051906 3300006871 Bacteria 4074
44 Ga0075429_100017687 3300006880 Bacteria 6165
45 Ga0075429_100382981 3300006880 Bacteria 1231
46 Ga0075429_100897070 3300006880 Unclassified 776
47 Ga0097620_100070360 3300006931 Unclassified 3534
48 Ga0097620_100906488 3300006931 Bacteria 966
49 Ga0075435_100035919 3300007076 Unclassified 3935
50 Ga0111539_10066876 3300009094 Bacteria 4245
51 Ga0111539_10263399 3300009094 Bacteria 2007
52 Ga0114129_10133749 3300009147 Bacteria 3404
53 Ga0114129_10454008 3300009147 Bacteria 1680
54 Ga0114129_12013886 3300009147 Unclassified 698
55 Ga0114129_12202816 3300009147 Unclassified 663
56 Ga0105241_11232144 3300009174 Bacteria 710
57 Ga0105242_10661727 3300009176 Unclassified 1017
58 Ga0105248_10547010 3300009177 Bacteria 1306
59 Ga0105248_10555213 3300009177 Bacteria 1296
60 Ga0105248_10851803 3300009177 Unclassified 1029
61 Ga0105237_11967518 3300009545 Unclassified 593
62 Ga0105237_12370210 3300009545 Unclassified 541
63 Ga0105246_10412505 3300011119 Unclassified 1125
64 Ga0157374_10110491 3300013296 Bacteria 2644
65 Ga0157374_10262317 3300013296 Bacteria 1702
66 Ga0157378_10272360 3300013297 Bacteria 1629
67 Ga0163162_10483132 3300013306 Bacteria 1370
68 Ga0157375_10375592 3300013308 Bacteria 1588
69 Ga0157375_10821218 3300013308 Unclassified 1078
70 Ga0157375_10873016 3300013308 Unclassified 1045
71 Ga0163163_10138783 3300014325 Bacteria 2473
72 Ga0163163_11372925 3300014325 Unclassified 768
73 Ga0157379_10767437 3300014968 Unclassified 908
74 Ga0157376_10294971 3300014969 Bacteria 1532
75 Ga0213874_10203593 3300021377 Bacteria 713
76 Ga0213876_10088136 3300021384 Bacteria 1643
77 Ga0207699_10257493 3300025906 Bacteria 1205
78 Ga0207707_10118754 3300025912 Bacteria 2311
79 Ga0207652_10213370 3300025921 Unclassified 1739
80 Ga0207700_10923966 3300025928 Unclassified 781
81 Ga0207686_10319580 3300025934 Bacteria 1159
82 Ga0207670_10181955 3300025936 Unclassified 1584
83 Ga0207704_10350872 3300025938 Bacteria 1149
84 Ga0207711_10145652 3300025941 Bacteria 2134
85 Ga0207711_10686726 3300025941 Bacteria 955
86 Ga0207711_11613594 3300025941 Bacteria 592
87 Ga0207689_11169444 3300025942 Unclassified 648
88 Ga0207641_10111899 3300026088 Bacteria 2422
89 Ga0207698_12348943 3300026142 Unclassified 545
90 Ga0207428_10133170 3300027907 Bacteria 1901
91 Ga0268266_10485087 3300028379 Bacteria 1178
92 Ga0265760_10024492 3300031090 Bacteria 1759
93 Ga0265330_10279969 3300031235 Unclassified 703
94 Ga0265325_10235866 3300031241 Bacteria 833
95 Ga0265316_10001267 3300031344 Bacteria 27125
96 Ga0265316_10042724 3300031344 Bacteria 3620
97 Ga0265316_10116960 3300031344 Bacteria 2015
98 Ga0265316_10161900 3300031344 Unclassified 1672
99 Ga0265316_10376828 3300031344 Bacteria 1024
100 Ga0373932_0214310 3300035112 Unclassified 689
101 Ga0373953_0560090 3300035117 Unclassified 508
102 Ga0373954_0007383 3300035118 Bacteria 4811
103 Ga0373962_0157255 3300035242 Unclassified 748
104 Ga0373931_0254647 3300035691 Unclassified 1069
105 Ga0373935_0882667 3300035692 Unclassified 662
106 Ga0373927_0003745 3300035695 Viruses 10796
107 Ga0373933_0036942 3300035724 Bacteria 2863
108 Ga0373933_0108944 3300035724 Bacteria 1726
109 Ga0373947_0132031 3300035725 Bacteria 1595
110 Ga0373947_0132422 3300035725 Bacteria 1593
111 Ga0373937_0103903 3300036401 Bacteria 2639
112 Ga0373937_0216943 3300036401 Bacteria 1801
113 Ga0373925_0022361 3300037068 Archaea 4612
114 Ga0436364_0754225 3300037853 Bacteria 1910
115 Ga0436364_1126824 3300037853 Unclassified 647
116 Ga0436365_0805628 3300039437 Bacteria 740
117 Ga0436365_0888299 3300039437 Bacteria 995
118 Ga0436361_1187713 3300039447 Unclassified 670
119 Ga0436363_0539831 3300039450 Bacteria 1491
120 Ga0436363_1427166 3300039450 Unclassified 881
121 Ga0453684_0350567 3300044712 Unclassified 1665
122 Ga0451576_0117771 3300045051 Unclassified 2765
123 Ga0451576_0700931 3300045051 Bacteria 1064
124 Ga0451576_0735028 3300045051 Bacteria 1037
125 Ga0495580_0001145 3300046472 Bacteria 23356
126 Ga0495580_0472827 3300046472 Unclassified 839
127 Ga0495652_0176668 3300046529 Bacteria 1643
128 Ga0495645_0216036 3300046543 Bacteria 1292
129 Ga0495674_0173445 3300047319 Bacteria 1799
130 Ga0495684_0226666 3300047471 Unclassified 1368
131 Ga0495684_0317501 3300047471 Bacteria 1115
132 Ga0501298_031884 3300049521 Unclassified 1038
133 Ga0501032_0682151 3300049569 Unclassified 652
134 Ga0501073_0003869 3300049589 Bacteria 11243
135 Ga0501073_0367267 3300049589 Bacteria 994
136 Ga0501079_0966237 3300049741 Unclassified 671
137 Ga0501080_0040032 3300049742 Unclassified 4373
138 Ga0501080_0070786 3300049742 Bacteria 3244
139 Ga0501081_0148381 3300049743 Bacteria 1683
140 Ga0501083_0308824 3300049744 Unclassified 1029
141 nmdc:mga05p37_44721_c1 3300050507 Bacteria 5448
142 nmdc:mga09592_147021_c1 3300050508 Bacteria 2032
143 nmdc:mga09592_386605_c1 3300050508 Bacteria 1210
144 nmdc:mga09592_594211_c1 3300050508 Unclassified 949
145 nmdc:mga06r32_609895_c1 3300050510 Unclassified 1062
146 nmdc:mga08y16_1077589_c1 3300050511 Bacteria 780
147 nmdc:mga08y16_419364_c1 3300050511 Bacteria 1368
148 nmdc:mga08y16_56693_c1 3300050511 Bacteria 4094
149 nmdc:mga0n895_135_c1 3300050512 Bacteria 44252
150 nmdc:mga0n895_33163_c1 3300050512 Bacteria 4961
151 nmdc:mga0rr50_166_c1 3300050513 Bacteria 35244
152 nmdc:mga0rr50_321860_c1 3300050513 Unclassified 1297
153 nmdc:mga08x19_108980_c1 3300050514 Bacteria 1845
154 nmdc:mga08x19_82774_c1 3300050514 Bacteria 2109
155 nmdc:mga0a205_1682_c1 3300050515 Bacteria 19080
156 nmdc:mga0a205_272490_c1 3300050515 Bacteria 1569
157 nmdc:mga0a205_99872_c1 3300050515 Bacteria 2801
158 Ga0501084_0005720 3300054114 Bacteria 10218
159 Ga0501082_0007742 3300060353 Bacteria 9273
160 Ga0501082_0848916 3300060353 Unclassified 799
161 Ga0501082_1056974 3300060353 Bacteria 710
162 Ga0105248_10942673
163 rootL2_10253795
164 Ga0070658_11948772
165 Ga0068868_100747568
166 Ga0070689_100165788
167 Ga0070671_100092004
168 Ga0070688_100210707
169 Ga0070709_10305455
170 Ga0070711_100657264
171 Ga0070705_100149538
172 Ga0070708_101506485
173 Ga0070681_10146080
174 Ga0070707_102117596
175 Ga0070698_101113946
176 Ga0070699_100417590
177 Ga0070679_100537289
178 Ga0070697_100071233
179 Ga0070686_100982014
180 Ga0070665_100019398
181 Ga0070704_100511797
182 Ga0070704_100713075
183 Ga0070704_101481778
184 Ga0068859_100070361
185 Ga0068859_100906351
186 Ga0068863_100439299
187 Ga0068863_100456932
188 Ga0068858_101131812
189 Ga0068860_100163452
190 Ga0068860_101066494
191 Ga0070717_11095801
192 Ga0075432_10016845
193 Ga0097621_100210376
194 Ga0097621_101392758
195 Ga0075428_100604477
196 Ga0075428_100989168
197 Ga0075430_100359974
198 Ga0075430_100658061
199 Ga0075431_100345458
200 Ga0075433_10038471
201 Ga0075433_10081469
202 Ga0075433_10320773
203 Ga0075434_100000332
204 Ga0075434_100051906
205 Ga0075429_100017687
206 Ga0075429_100382981
207 Ga0075429_100897070
208 Ga0097620_100070360
209 Ga0097620_100906488
210 Ga0075435_100035919
211 Ga0111539_10066876
212 Ga0111539_10263399
213 Ga0114129_10133749
214 Ga0114129_10454008
215 Ga0114129_12013886
216 Ga0114129_12202816
217 Ga0105241_11232144
218 Ga0105242_10661727
219 Ga0105248_10547010
220 Ga0105248_10555213
221 Ga0105248_10851803
222 Ga0105237_11967518
223 Ga0105237_12370210
224 Ga0105246_10412505
225 Ga0157374_10110491
226 Ga0157374_10262317
227 Ga0157378_10272360
228 Ga0163162_10483132
229 Ga0157375_10375592
230 Ga0157375_10821218
231 Ga0157375_10873016
232 Ga0163163_10138783
233 Ga0163163_11372925
234 Ga0157379_10767437
235 Ga0157376_10294971
236 Ga0213874_10203593
237 Ga0213876_10088136
238 Ga0207699_10257493
239 Ga0207707_10118754
240 Ga0207652_10213370
241 Ga0207700_10923966
242 Ga0207686_10319580
243 Ga0207670_10181955
244 Ga0207704_10350872
245 Ga0207711_10145652
246 Ga0207711_10686726
247 Ga0207711_11613594
248 Ga0207689_11169444
249 Ga0207641_10111899
250 Ga0207698_12348943
251 Ga0207428_10133170
252 Ga0268266_10485087
253 Ga0265760_10024492
254 Ga0265330_10279969
255 Ga0265325_10235866
256 Ga0265316_10001267
257 Ga0265316_10042724
258 Ga0265316_10116960
259 Ga0265316_10161900
260 Ga0265316_10376828
261 Ga0373932_0214310
262 Ga0373953_0560090
263 Ga0373954_0007383
264 Ga0373962_0157255
265 Ga0373931_0254647
266 Ga0373935_0882667
267 Ga0373927_0003745
268 Ga0373933_0036942
269 Ga0373933_0108944
270 Ga0373947_0132031
271 Ga0373947_0132422
272 Ga0373937_0103903
273 Ga0373937_0216943
274 Ga0373925_0022361
275 Ga0436364_0754225
276 Ga0436364_1126824
277 Ga0436365_0805628
278 Ga0436365_0888299
279 Ga0436361_1187713
280 Ga0436363_0539831
281 Ga0436363_1427166
282 Ga0453684_0350567
283 Ga0451576_0117771
284 Ga0451576_0700931
285 Ga0451576_0735028
286 Ga0495580_0001145
287 Ga0495580_0472827
288 Ga0495652_0176668
289 Ga0495645_0216036
290 Ga0495674_0173445
291 Ga0495684_0226666
292 Ga0495684_0317501
293 Ga0501298_031884
294 Ga0501032_0682151
295 Ga0501073_0003869
296 Ga0501073_0367267
297 Ga0501079_0966237
298 Ga0501080_0040032
299 Ga0501080_0070786
300 Ga0501081_0148381
301 Ga0501083_0308824
302 nmdc:mga05p37_44721_c1
303 nmdc:mga09592_147021_c1
304 nmdc:mga09592_386605_c1
305 nmdc:mga09592_594211_c1
306 nmdc:mga06r32_609895_c1
307 nmdc:mga08y16_1077589_c1
308 nmdc:mga08y16_419364_c1
309 nmdc:mga08y16_56693_c1
310 nmdc:mga0n895_135_c1
311 nmdc:mga0n895_33163_c1
312 nmdc:mga0rr50_166_c1
313 nmdc:mga0rr50_321860_c1
314 nmdc:mga08x19_108980_c1
315 nmdc:mga08x19_82774_c1
316 nmdc:mga0a205_1682_c1
317 nmdc:mga0a205_272490_c1
318 nmdc:mga0a205_99872_c1
319 Ga0501084_0005720
320 Ga0501082_0007742
321 Ga0501082_0848916
322 Ga0501082_1056974

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

4

125

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ecy-assembly1.cif.gz_H structure of the shigella flexneri vapc mutant d98n crystal form 2 0.9241 1 126
5ecw-assembly1.cif.gz_B structure of the shigella flexneri vapc mutant d7a 0.9173 1 130
6sd6-assembly1.cif.gz_C structure of vapbc from shigella sonnei 0.9126 1 128
3zvk-assembly1.cif.gz_B crystal structure of vapbc2 from rickettsia felis bound to a dna fragment from their promoter 0.9099 1 129
3tnd-assembly1.cif.gz_G crystal structure of shigella flexneri vapbc toxin-antitoxin complex 0.9068 1 127
ID Description Score Start End Superfamily
5ecwB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9173 1 130 3.40.50.1010
2w11A02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9141 71 108 1.10.150.240
2w11B02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9141 71 108 1.10.150.240
3zvkB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9099 1 129 3.40.50.1010
5ecwB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9032 1 130 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A6B1DSQ8-F1-model_v4 Type II toxin-antitoxin system VapC family toxin 0.9976 69 129
AF-A0A1H6FIY1-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9955 1 127 GO:0000287
GO:0004540
GO:0090729
AF-A0A6B1DEC9-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9947 2 130 GO:0000287
GO:0004540
GO:0090729
AF-A0A0G0UBJ6-F1-model_v4 PilT protein domain protein 0.9945 2 127 GO:0004518
GO:0046872
AF-A0A6L8JDC9-F1-model_v4 deleted 0.9939 1 129

Map