F235242

General Info

Members Datasets Scaffolds Average Seq Length
160 90 320 150

Family's Representative Sequence

Representative Sequence 3300044684|Ga0466966_0042629|Ga0466966_0042629_2057_2557
Length 166
Sequence MPAASEPGAGRGSGAGGPRQVALPHTWRPFGVRVAGTIFGVGLLAVCVMTWIGFDDATRAKFTMFQRGTLVFFGVLGFALWFALVRSRVVAEAERLVVVNGYRRHEYAWPQVVAVRMPPGAPWVTLDLADGTSAAAMGIQGSDGDRXXXXVRELRAVVDRQTRLSD

Samples

Sample ID Description Type Environment
1 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
2 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
3 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
4 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
5 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
6 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
7 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
8 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
9 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
10 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
11 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
12 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
13 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
14 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
15 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
16 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
20 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
23 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
25 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
26 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
27 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
28 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
29 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
30 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
31 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
32 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
33 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
34 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
35 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
36 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
37 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
38 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
39 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
40 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
41 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
42 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
43 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
44 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
45 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
46 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
47 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
48 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
49 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
50 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
51 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
52 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
53 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
54 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
55 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
56 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
57 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
58 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
59 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
60 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
61 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
62 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
63 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
64 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
65 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
66 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
67 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
68 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
69 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
70 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
71 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
72 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
73 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
74 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
77 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
78 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
79 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
80 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
81 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
82 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
83 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
84 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
85 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
86 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
87 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
88 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
89 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
90 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0
Isolates 0.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 34.38
Nodule 0
Rhizoplane 5
Rhizosphere 57.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466966_0042629 3300044684 Bacteria 2911
2 Ga0070668_101230197 3300005347 Bacteria 679
3 Ga0070667_100069706 3300005367 Bacteria 2993
4 Ga0070684_100602816 3300005535 Bacteria 1021
5 Ga0068852_100364510 3300005616 Bacteria 1414
6 Ga0068860_100005003 3300005843 Bacteria 13499
7 Ga0075365_10127460 3300006038 Bacteria 1759
8 Ga0075365_10592504 3300006038 Bacteria 784
9 Ga0075365_10791022 3300006038 Bacteria 669
10 Ga0075363_100013914 3300006048 Bacteria 3917
11 Ga0075363_100025796 3300006048 Bacteria 3001
12 Ga0075363_100055875 3300006048 Bacteria 2115
13 Ga0075363_100153817 3300006048 Bacteria 1299
14 Ga0075363_100201406 3300006048 Bacteria 1137
15 Ga0075363_100315062 3300006048 Bacteria 910
16 Ga0075364_10020774 3300006051 Bacteria 4132
17 Ga0075364_10033643 3300006051 Bacteria 3302
18 Ga0075364_10167838 3300006051 Bacteria 1483
19 Ga0075364_10426499 3300006051 Bacteria 905
20 Ga0075362_10066961 3300006177 Bacteria 1633
21 Ga0075367_10006231 3300006178 Bacteria 6010
22 Ga0075367_10275296 3300006178 Bacteria 1058
23 Ga0075367_10511061 3300006178 Bacteria 762
24 Ga0075367_10600258 3300006178 Bacteria 699
25 Ga0075370_10005532 3300006353 Bacteria 6294
26 Ga0075370_10055175 3300006353 Bacteria 2257
27 Ga0075370_10141648 3300006353 Bacteria 1406
28 Ga0075370_10161132 3300006353 Bacteria 1317
29 Ga0075370_10195850 3300006353 Bacteria 1191
30 Ga0157375_11196118 3300013308 Bacteria 891
31 Ga0157380_10147681 3300014326 Bacteria 2028
32 Ga0163161_10441573 3300017792 Bacteria 1050
33 Ga0163161_11389656 3300017792 Bacteria 613
34 Ga0207662_10329937 3300025918 Bacteria 1020
35 Ga0207669_10560054 3300025937 Bacteria 924
36 Ga0207678_10267821 3300026067 Bacteria 1465
37 Ga0207675_100153426 3300026118 Bacteria 2194
38 Ga0207683_10046338 3300026121 Bacteria 3804
39 Ga0207698_10232875 3300026142 Bacteria 1673
40 Ga0207698_10917148 3300026142 Bacteria 884
41 Ga0209813_10002982 3300027866 Bacteria 3923
42 Ga0209813_10036918 3300027866 Bacteria 1470
43 Ga0268264_10001670 3300028381 Bacteria 20420
44 Ga0268264_10966959 3300028381 Bacteria 857
45 Ga0307410_10058817 3300031852 Bacteria 2622
46 Ga0307412_10401289 3300031911 Bacteria 1116
47 Ga0307409_100178140 3300031995 Bacteria 1878
48 Ga0307409_100244360 3300031995 Bacteria 1636
49 Ga0307416_100039291 3300032002 Bacteria 3662
50 Ga0307416_100387620 3300032002 Bacteria 1430
51 Ga0307411_10810282 3300032005 Bacteria 825
52 Ga0307415_100004524 3300032126 Bacteria 7234
53 Ga0307415_100579749 3300032126 Bacteria 995
54 Ga0307415_100864815 3300032126 Bacteria 831
55 Ga0395900_0968274 3300037418 Bacteria 772
56 Ga0395901_0295624 3300038443 Bacteria 1680
57 Ga0436365_1437153 3300039437 Bacteria 771
58 Ga0451800_0797664 3300041459 Bacteria 1773
59 Ga0451807_1891079 3300041486 Bacteria 663
60 Ga0451839_1517226 3300041496 Bacteria 658
61 Ga0451853_1226621 3300041512 Bacteria 673
62 Ga0451853_1258753 3300041512 Bacteria 716
63 Ga0466972_0103025 3300044658 Bacteria 1350
64 Ga0466972_0242136 3300044658 Bacteria 844
65 Ga0466965_0070092 3300044683 Bacteria 1762
66 Ga0466961_0023301 3300044693 Bacteria 3983
67 Ga0466961_0372731 3300044693 Bacteria 867
68 Ga0466961_0808398 3300044693 Bacteria 559
69 Ga0466961_0905557 3300044693 Bacteria 525
70 Ga0466963_0039928 3300044694 Bacteria 3075
71 Ga0466963_0165892 3300044694 Bacteria 1538
72 Ga0466963_0214269 3300044694 Bacteria 1348
73 Ga0466964_0150844 3300044706 Bacteria 1077
74 Ga0466968_0030799 3300044735 Bacteria 2224
75 Ga0466970_0120426 3300044765 Bacteria 1437
76 Ga0466970_0261122 3300044765 Bacteria 972
77 Ga0466957_0106107 3300044842 Bacteria 1776
78 Ga0466960_0246191 3300044901 Bacteria 991
79 Ga0466960_0860832 3300044901 Bacteria 551
80 Ga0466958_0896573 3300045836 Bacteria 578
81 Ga0466967_0216891 3300045976 Bacteria 1816
82 Ga0496102_0391145 3300048905 Bacteria 1308
83 Ga0496106_0637842 3300048909 Bacteria 852
84 Ga0496107_0234731 3300048910 Bacteria 1365
85 Ga0496110_0047343 3300048913 Bacteria 3765
86 Ga0496110_1363059 3300048913 Bacteria 619
87 Ga0496111_0175752 3300048914 Bacteria 1592
88 Ga0501031_0071738 3300049568 Bacteria 2255
89 Ga0501031_0094969 3300049568 Bacteria 1945
90 Ga0501033_0106976 3300049570 Bacteria 2038
91 Ga0501034_0010188 3300049571 Bacteria 9807
92 Ga0501034_1213615 3300049571 Bacteria 633
93 Ga0501036_0004485 3300049572 Bacteria 11287
94 Ga0501037_0008738 3300049573 Bacteria 7425
95 Ga0501038_0005276 3300049574 Bacteria 12019
96 Ga0501040_0092000 3300049576 Bacteria 2109
97 Ga0501040_0556488 3300049576 Bacteria 828
98 Ga0501041_0453794 3300049577 Bacteria 814
99 Ga0501042_0340221 3300049578 Bacteria 1085
100 Ga0501042_0562911 3300049578 Bacteria 828
101 Ga0501046_0036348 3300049580 Bacteria 3964
102 Ga0501067_0048962 3300049583 Bacteria 2343
103 Ga0501067_0260040 3300049583 Bacteria 966
104 Ga0501068_0039728 3300049584 Bacteria 2822
105 Ga0501069_0371855 3300049585 Bacteria 844
106 Ga0501069_1017090 3300049585 Bacteria 506
107 Ga0501070_0423417 3300049586 Bacteria 1075
108 Ga0501071_0014436 3300049587 Bacteria 5402
109 Ga0501071_0069023 3300049587 Bacteria 2573
110 Ga0501071_0562312 3300049587 Bacteria 876
111 Ga0501072_0517284 3300049588 Bacteria 944
112 Ga0501073_0155750 3300049589 Bacteria 1583
113 Ga0501074_0371624 3300049590 Bacteria 1014
114 Ga0501074_0629377 3300049590 Bacteria 758
115 Ga0501075_0141887 3300049591 Bacteria 1831
116 Ga0501075_0256095 3300049591 Bacteria 1334
117 Ga0501075_0431989 3300049591 Bacteria 1004
118 Ga0501079_0222231 3300049741 Bacteria 1476
119 Ga0501080_1499337 3300049742 Bacteria 573
120 Ga0501035_0009045 3300049822 Bacteria 9264
121 Ga0501044_0125598 3300049823 Bacteria 2563
122 Ga0501045_0346876 3300049824 Bacteria 1105
123 Ga0501045_0504762 3300049824 Bacteria 898
124 Ga0501045_0737798 3300049824 Bacteria 726
125 nmdc:mga03683_195491_c1 3300050489 Bacteria 927
126 nmdc:mga03n38_21780_c1 3300050490 Bacteria 2584
127 nmdc:mga03n38_320427_c1 3300050490 Bacteria 837
128 nmdc:mga03n38_795119_c1 3300050490 Bacteria 550
129 nmdc:mga00v17_107039_c1 3300050491 Bacteria 1770
130 nmdc:mga00v17_198000_c1 3300050491 Bacteria 1298
131 nmdc:mga00v17_213127_c1 3300050491 Bacteria 1250
132 nmdc:mga00v17_234771_c1 3300050491 Bacteria 1189
133 nmdc:mga00v17_80999_c1 3300050491 Bacteria 2027
134 nmdc:mga00v17_83630_c1 3300050491 Bacteria 1996
135 nmdc:mga0yw44_150293_c1 3300050492 Bacteria 1519
136 nmdc:mga0yw44_165617_c1 3300050492 Bacteria 1062
137 nmdc:mga0yw44_210446_c1 3300050492 Bacteria 1286
138 nmdc:mga0yw44_26362_c1 3300050492 Bacteria 3319
139 nmdc:mga0yw44_320339_c1 3300050492 Bacteria 1041
140 nmdc:mga0yw44_386710_c1 3300050492 Bacteria 945
141 nmdc:mga0yw44_408712_c1 3300050492 Bacteria 918
142 nmdc:mga0yw44_426417_c1 3300050492 Bacteria 898
143 nmdc:mga0yw44_62712_c1 3300050492 Bacteria 2284
144 nmdc:mga0yw44_646887_c1 3300050492 Bacteria 718
145 nmdc:mga0yw44_781804_c1 3300050492 Bacteria 648
146 nmdc:mga0yw44_8704_c2 3300050492 Bacteria 4007
147 nmdc:mga06z11_322228_c1 3300050494 Bacteria 922
148 nmdc:mga06z11_38987_c1 3300050494 Bacteria 2363
149 nmdc:mga04h51_177890_c1 3300050495 Bacteria 827
150 nmdc:mga07m45_143219_c1 3300050496 Bacteria 1385
151 nmdc:mga07m45_52037_c1 3300050496 Bacteria 2311
152 nmdc:mga07m45_77511_c1 3300050496 Bacteria 1896
153 Ga0500644_0000284 3300053088 Bacteria 28069
154 Ga0500573_0002587 3300053140 Bacteria 9104
155 Ga0501084_0093728 3300054114 Bacteria 2521
156 Ga0501082_0102530 3300060353 Bacteria 2475
157 Ga0466962_0013217 3300061719 Bacteria 3970
158 Ga0530510_1030705 3300061734 Bacteria 630
159 Ga0530510_1428839 3300061734 Bacteria 531
160 2855391126 2855386786 Bacteria 4752232
161 Ga0466966_0042629
162 Ga0070668_101230197
163 Ga0070667_100069706
164 Ga0070684_100602816
165 Ga0068852_100364510
166 Ga0068860_100005003
167 Ga0075365_10127460
168 Ga0075365_10592504
169 Ga0075365_10791022
170 Ga0075363_100013914
171 Ga0075363_100025796
172 Ga0075363_100055875
173 Ga0075363_100153817
174 Ga0075363_100201406
175 Ga0075363_100315062
176 Ga0075364_10020774
177 Ga0075364_10033643
178 Ga0075364_10167838
179 Ga0075364_10426499
180 Ga0075362_10066961
181 Ga0075367_10006231
182 Ga0075367_10275296
183 Ga0075367_10511061
184 Ga0075367_10600258
185 Ga0075370_10005532
186 Ga0075370_10055175
187 Ga0075370_10141648
188 Ga0075370_10161132
189 Ga0075370_10195850
190 Ga0157375_11196118
191 Ga0157380_10147681
192 Ga0163161_10441573
193 Ga0163161_11389656
194 Ga0207662_10329937
195 Ga0207669_10560054
196 Ga0207678_10267821
197 Ga0207675_100153426
198 Ga0207683_10046338
199 Ga0207698_10232875
200 Ga0207698_10917148
201 Ga0209813_10002982
202 Ga0209813_10036918
203 Ga0268264_10001670
204 Ga0268264_10966959
205 Ga0307410_10058817
206 Ga0307412_10401289
207 Ga0307409_100178140
208 Ga0307409_100244360
209 Ga0307416_100039291
210 Ga0307416_100387620
211 Ga0307411_10810282
212 Ga0307415_100004524
213 Ga0307415_100579749
214 Ga0307415_100864815
215 Ga0395900_0968274
216 Ga0395901_0295624
217 Ga0436365_1437153
218 Ga0451800_0797664
219 Ga0451807_1891079
220 Ga0451839_1517226
221 Ga0451853_1226621
222 Ga0451853_1258753
223 Ga0466972_0103025
224 Ga0466972_0242136
225 Ga0466965_0070092
226 Ga0466961_0023301
227 Ga0466961_0372731
228 Ga0466961_0808398
229 Ga0466961_0905557
230 Ga0466963_0039928
231 Ga0466963_0165892
232 Ga0466963_0214269
233 Ga0466964_0150844
234 Ga0466968_0030799
235 Ga0466970_0120426
236 Ga0466970_0261122
237 Ga0466957_0106107
238 Ga0466960_0246191
239 Ga0466960_0860832
240 Ga0466958_0896573
241 Ga0466967_0216891
242 Ga0496102_0391145
243 Ga0496106_0637842
244 Ga0496107_0234731
245 Ga0496110_0047343
246 Ga0496110_1363059
247 Ga0496111_0175752
248 Ga0501031_0071738
249 Ga0501031_0094969
250 Ga0501033_0106976
251 Ga0501034_0010188
252 Ga0501034_1213615
253 Ga0501036_0004485
254 Ga0501037_0008738
255 Ga0501038_0005276
256 Ga0501040_0092000
257 Ga0501040_0556488
258 Ga0501041_0453794
259 Ga0501042_0340221
260 Ga0501042_0562911
261 Ga0501046_0036348
262 Ga0501067_0048962
263 Ga0501067_0260040
264 Ga0501068_0039728
265 Ga0501069_0371855
266 Ga0501069_1017090
267 Ga0501070_0423417
268 Ga0501071_0014436
269 Ga0501071_0069023
270 Ga0501071_0562312
271 Ga0501072_0517284
272 Ga0501073_0155750
273 Ga0501074_0371624
274 Ga0501074_0629377
275 Ga0501075_0141887
276 Ga0501075_0256095
277 Ga0501075_0431989
278 Ga0501079_0222231
279 Ga0501080_1499337
280 Ga0501035_0009045
281 Ga0501044_0125598
282 Ga0501045_0346876
283 Ga0501045_0504762
284 Ga0501045_0737798
285 nmdc:mga03683_195491_c1
286 nmdc:mga03n38_21780_c1
287 nmdc:mga03n38_320427_c1
288 nmdc:mga03n38_795119_c1
289 nmdc:mga00v17_107039_c1
290 nmdc:mga00v17_198000_c1
291 nmdc:mga00v17_213127_c1
292 nmdc:mga00v17_234771_c1
293 nmdc:mga00v17_80999_c1
294 nmdc:mga00v17_83630_c1
295 nmdc:mga0yw44_150293_c1
296 nmdc:mga0yw44_165617_c1
297 nmdc:mga0yw44_210446_c1
298 nmdc:mga0yw44_26362_c1
299 nmdc:mga0yw44_320339_c1
300 nmdc:mga0yw44_386710_c1
301 nmdc:mga0yw44_408712_c1
302 nmdc:mga0yw44_426417_c1
303 nmdc:mga0yw44_62712_c1
304 nmdc:mga0yw44_646887_c1
305 nmdc:mga0yw44_781804_c1
306 nmdc:mga0yw44_8704_c2
307 nmdc:mga06z11_322228_c1
308 nmdc:mga06z11_38987_c1
309 nmdc:mga04h51_177890_c1
310 nmdc:mga07m45_143219_c1
311 nmdc:mga07m45_52037_c1
312 nmdc:mga07m45_77511_c1
313 Ga0500644_0000284
314 Ga0500573_0002587
315 Ga0501084_0093728
316 Ga0501082_0102530
317 Ga0466962_0013217
318 Ga0530510_1030705
319 Ga0530510_1428839
320 2855391126

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10756

bPH_6

Bacterial PH domain

86

156

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7x2y-assembly1.cif.gz_A crystal structure of cis-4,5-dihydrodiol phthalate dehydrogenase in complex with nad+ and 3-hydroxybenzoate 0.8072 79 101
8djq-assembly1.cif.gz_C sliding-clamp-dnae1 peptide 0.8024 80 101
7wzd-assembly1.cif.gz_A crystal structure of cis-4,5-dihydrodiol phthalate dehydrogenase from comamonas testosteroni kf1 0.8012 79 101
8djq-assembly2.cif.gz_B sliding-clamp-dnae1 peptide 0.7996 80 101
7wzd-assembly1.cif.gz_B crystal structure of cis-4,5-dihydrodiol phthalate dehydrogenase from comamonas testosteroni kf1 0.7991 79 101
ID Description Score Start End Superfamily
af_P9WLY1_72_143_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.9254 79 149 2.30.29.30
af_P9WLY1_72_143_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.9018 79 149 2.30.29.30
af_K7LFM7_8_371_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8684 104 130 3.50.50.60
af_M9PE65_477_668_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.8343 80 101 2.60.120.200
af_P10040_1021_1198_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.8263 80 101 2.60.120.200
ID Description Score Start End GO Terms
AF-A0A519GI28-F1-model_v4 PH domain-containing protein 0.9756 59 158
AF-A0A1G8XFE5-F1-model_v4 PH domain-containing protein 0.9689 14 155 GO:0016020
AF-A0A7X7S4M6-F1-model_v4 PH domain-containing protein 0.9678 80 153
AF-A0A1G8XFE5-F1-model_v4 PH domain-containing protein 0.9623 14 155 GO:0016020
AF-A0A3D1L891-F1-model_v4 deleted 0.9564 71 152

Map