F235122

General Info

Members Datasets Scaffolds Average Seq Length
160 104 145 194

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0923894|Ga0395905_0923894_45_629
Length 194
Sequence MLTLVAGLVLFLGAHSVRVFAEGWRAATIASVGERPWKGVYSLVSLAGFALIVVGFGLARQNPIVLWPQPPVATRHLAALLTLVAFVLVVAAYVPGNQLKAKLHHPMLLGVKAWALGHLLANNTVADVLLFGSFLAWAVLDFRAARKRDRAQGTVYAPGTVSRTVIAVVVGVVAWAVFAFWLHRVLIGVSPMGV

Samples

Sample ID Description Type Environment
1 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
2 2643221645 Massilia sp. Root351 Isolate Unclassified
3 2643221660 Methylibium sp. Root1272 Isolate Unclassified
4 2643221664 Massilia sp. Root418 Isolate Unclassified
5 2738541280 Massilia sp. GV090 Isolate Unclassified
6 2738541297 Duganella sp. GV083 Isolate Unclassified
7 2738541300 Massilia sp. GV016 Isolate Unclassified
8 2738541357 Duganella sp. GV053 Isolate Unclassified
9 2738543003 Duganella sp. GV066 Isolate Unclassified
10 2738543018 Massilia sp. GV045 Isolate Unclassified
11 2738543026 Duganella sp. GV089 Isolate Unclassified
12 2738543029 Duganella sp. GV039 Isolate Unclassified
13 2738543030 Massilia sp. GV097 Isolate Unclassified
14 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
15 2842711865 Duganella sp. R-73148 Isolate Unclassified
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
20 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
21 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
22 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
23 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
24 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
26 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
27 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
28 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
29 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
30 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
31 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
32 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
33 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
34 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
35 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
36 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
37 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
38 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
39 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
40 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
41 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
42 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
43 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
44 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
45 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
46 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
47 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
48 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
49 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
50 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
51 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
52 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
53 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
54 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
55 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
56 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
57 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
58 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
59 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
60 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
61 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
62 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
63 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
64 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
65 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
66 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
67 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
68 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
69 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
70 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
71 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
72 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
73 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
74 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
75 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
76 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
77 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
78 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
79 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
80 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
81 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
82 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
83 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
84 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
85 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
86 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
87 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
96 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
97 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
99 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
100 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
101 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
102 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
103 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
104 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.62
Metatranscriptomes 0
Isolates 9.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.88
Nodule 0
Rhizoplane 1.88
Rhizosphere 81.25
Stem 0
Stem Tuber 0
Unclassified 10

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070660_100546573 3300005339 Bacteria 966
2 Ga0068863_100197870 3300005841 Bacteria 1932
3 Ga0068858_100101464 3300005842 Bacteria 2684
4 Ga0075370_10182965 3300006353 Bacteria 1234
5 Ga0157372_10014231 3300013307 Bacteria 8503
6 Ga0213872_10000001 3300021361 Bacteria 662532
7 Ga0213872_10000040 3300021361 Bacteria 122419
8 Ga0213872_10065757 3300021361 Bacteria 1637
9 Ga0213872_10086842 3300021361 Unclassified 1402
10 Ga0209437_103432 3300025233 Bacteria 2873
11 Ga0209437_109677 3300025233 Bacteria 1495
12 Ga0209455_1000043 3300025272 Bacteria 413928
13 Ga0207641_10302122 3300026088 Bacteria 1512
14 Ga0316575_10206836 3300031665 Unclassified 817
15 Ga0307412_10882208 3300031911 Bacteria 783
16 Ga0395899_0043994 3300037312 Bacteria 3327
17 Ga0395900_0265991 3300037418 Bacteria 1711
18 Ga0395905_0050336 3300037471 Bacteria 3903
19 Ga0395905_0255554 3300037471 Bacteria 1636
20 Ga0395905_0923894 3300037471 Bacteria 775
21 Ga0395901_1117821 3300038443 Bacteria 758
22 Ga0436361_0021023 3300039447 Bacteria 16456
23 Ga0436361_0424705 3300039447 Bacteria 4836
24 Ga0436361_0709782 3300039447 Bacteria 904
25 Ga0436361_1185928 3300039447 Bacteria 172199
26 Ga0439439_0004237 3300041406 Bacteria 3220
27 Ga0439433_0009313 3300041999 Bacteria 2137
28 Ga0439449_0000321 3300042007 Bacteria 17412
29 Ga0439457_022190 3300042014 Bacteria 1405
30 Ga0439462_0001735 3300042015 Bacteria 4927
31 Ga0439462_0028265 3300042015 Bacteria 1482
32 Ga0450898_012304 3300042134 Bacteria 1413
33 Ga0439464_0011368 3300042439 Bacteria 2358
34 Ga0451577_0117443 3300042876 Bacteria 2383
35 Ga0451577_0131023 3300042876 Bacteria 2249
36 Ga0451577_0204432 3300042876 Bacteria 1783
37 Ga0453684_1250948 3300044712 Bacteria 777
38 Ga0451576_0048552 3300045051 Bacteria 4457
39 Ga0451576_0097197 3300045051 Bacteria 3063
40 Ga0451576_1141861 3300045051 Bacteria 815
41 Ga0466967_0235384 3300045976 Bacteria 1745
42 Ga0466967_0393064 3300045976 Bacteria 1348
43 Ga0495638_0074311 3300046460 Bacteria 2073
44 Ga0495638_0120487 3300046460 Bacteria 1551
45 Ga0495650_0000019 3300046471 Bacteria 533849
46 Ga0495650_0000267 3300046471 Bacteria 100234
47 Ga0495650_0000427 3300046471 Bacteria 68283
48 Ga0495584_0076321 3300046491 Bacteria 1685
49 Ga0495585_0001650 3300046492 Bacteria 17066
50 Ga0495585_0008219 3300046492 Bacteria 6335
51 Ga0495607_0023487 3300046501 Bacteria 3859
52 Ga0495607_0025546 3300046501 Bacteria 3672
53 Ga0495583_0000115 3300046506 Bacteria 135762
54 Ga0495583_0000205 3300046506 Bacteria 99711
55 Ga0495606_0003462 3300046507 Bacteria 16739
56 Ga0495606_0035249 3300046507 Bacteria 3422
57 Ga0495606_0053064 3300046507 Bacteria 2632
58 Ga0495610_0000003 3300046512 Bacteria 1203910
59 Ga0495610_0001513 3300046512 Bacteria 20446
60 Ga0495610_0007752 3300046512 Bacteria 7086
61 Ga0495616_0010736 3300046513 Bacteria 5283
62 Ga0495643_0033740 3300046522 Bacteria 2829
63 Ga0495643_0144284 3300046522 Bacteria 1184
64 Ga0495644_0016078 3300046523 Bacteria 2865
65 Ga0495648_0004796 3300046524 Bacteria 11429
66 Ga0495648_0012888 3300046524 Bacteria 6210
67 Ga0495648_0019468 3300046524 Bacteria 4772
68 Ga0495648_0042431 3300046524 Bacteria 2861
69 Ga0495648_0063007 3300046524 Bacteria 2192
70 Ga0495642_0079245 3300046528 Bacteria 1381
71 Ga0495654_0003468 3300046530 Bacteria 9640
72 Ga0495654_0030682 3300046530 Bacteria 2733
73 Ga0495609_0001329 3300046538 Bacteria 16777
74 Ga0495609_0003877 3300046538 Bacteria 8393
75 Ga0495609_0101615 3300046538 Bacteria 1245
76 Ga0495597_0027363 3300046542 Bacteria 2614
77 Ga0495597_0102767 3300046542 Bacteria 1203
78 Ga0495622_0000001 3300046557 Bacteria 365248
79 Ga0495633_0000055 3300046558 Bacteria 151013
80 Ga0495633_0001534 3300046558 Bacteria 17734
81 Ga0495633_0001714 3300046558 Bacteria 16417
82 Ga0495656_0001780 3300046615 Bacteria 7074
83 Ga0495656_0159483 3300046615 Bacteria 1095
84 Ga0495668_0000678 3300046616 Bacteria 41065
85 Ga0495668_0194492 3300046616 Bacteria 1111
86 Ga0495611_0001239 3300046648 Bacteria 13133
87 Ga0495611_0003096 3300046648 Bacteria 7385
88 Ga0495625_0008272 3300046660 Bacteria 8893
89 Ga0495625_0012725 3300046660 Bacteria 6805
90 Ga0495625_0019615 3300046660 Bacteria 5238
91 Ga0495625_0092148 3300046660 Bacteria 2094
92 Ga0495659_0000049 3300046664 Bacteria 52682
93 Ga0495659_0002110 3300046664 Bacteria 6485
94 Ga0495661_0017195 3300046665 Bacteria 4778
95 Ga0495661_0056385 3300046665 Bacteria 2351
96 Ga0495661_0326471 3300046665 Bacteria 761
97 Ga0495588_0084817 3300046674 Bacteria 1655
98 Ga0495670_0002367 3300046691 Bacteria 9281
99 Ga0495671_0000010 3300046692 Bacteria 368641
100 Ga0495671_0000498 3300046692 Bacteria 30297
101 Ga0495671_0063722 3300046692 Bacteria 1815
102 Ga0495589_0071331 3300046794 Bacteria 1698
103 Ga0495589_0399813 3300046794 Bacteria 631
104 Ga0495660_0000514 3300046810 Bacteria 31796
105 Ga0495660_0007526 3300046810 Bacteria 6393
106 Ga0495636_0000360 3300047318 Bacteria 17371
107 Ga0495672_0000026 3300047320 Bacteria 340319
108 Ga0495683_0007944 3300047323 Bacteria 5693
109 Ga0495687_000446 3300047443 Bacteria 50964
110 Ga0495677_0003304 3300047445 Bacteria 6278
111 Ga0495677_0044405 3300047445 Bacteria 1629
112 Ga0495679_021379 3300047446 Bacteria 2235
113 Ga0495685_000084 3300047447 Bacteria 34726
114 Ga0495673_0000003 3300047469 Bacteria 1491337
115 Ga0495673_0000016 3300047469 Bacteria 580643
116 Ga0495673_0002371 3300047469 Bacteria 13366
117 Ga0495686_0009399 3300047472 Bacteria 7047
118 Ga0496102_0018227 3300048905 Bacteria 6164
119 Ga0496103_0087266 3300048906 Bacteria 1966
120 Ga0496110_0560392 3300048913 Bacteria 1038
121 Ga0496124_0011069 3300048927 Bacteria 9055
122 Ga0495678_000549 3300049459 Bacteria 36201
123 Ga0495682_0000328 3300049460 Bacteria 35328
124 Ga0495682_0000349 3300049460 Bacteria 33881
125 Ga0501032_0037390 3300049569 Bacteria 3311
126 Ga0501034_0391967 3300049571 Bacteria 1313
127 Ga0501036_0328056 3300049572 Bacteria 1279
128 Ga0501037_0053284 3300049573 Bacteria 2959
129 Ga0501038_0181432 3300049574 Bacteria 1698
130 Ga0501042_0169672 3300049578 Bacteria 1575
131 Ga0501043_0069372 3300049579 Bacteria 2768
132 Ga0501047_0005509 3300049581 Bacteria 11910
133 Ga0501047_0139696 3300049581 Bacteria 2301
134 Ga0501070_0057588 3300049586 Bacteria 3222
135 Ga0501070_0292790 3300049586 Bacteria 1327
136 Ga0501230_038935 3300049667 Bacteria 914
137 Ga0501035_0202488 3300049822 Bacteria 1701
138 Ga0501044_0154184 3300049823 Bacteria 2277
139 nmdc:mga0k408_206544_c1 3300050493 Bacteria 1172
140 nmdc:mga07m45_324106_c1 3300050496 Bacteria 895
141 Ga0500593_000692 3300053117 Bacteria 12817
142 Ga0500618_000068 3300053125 Bacteria 88668
143 Ga0500586_000143 3300053145 Bacteria 13007
144 Ga0500586_000449 3300053145 Bacteria 8215
145 Ga0500636_0235180 3300053177 Bacteria 945

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041406 Ga0439439_0004237 Ga0439439_0004237_223_813 158
2 3300041999 Ga0439433_0009313 Ga0439433_0009313_697_1287 158
3 3300042007 Ga0439449_0000321 Ga0439449_0000321_12815_13405 158
4 3300042014 Ga0439457_022190 Ga0439457_022190_780_1370 158
5 3300042015 Ga0439462_0001735 Ga0439462_0001735_2465_3055 158
6 3300031911 Ga0307412_10882208 Ga0307412_108822081 167
7 3300046665 Ga0495661_0017195 Ga0495661_0017195_3698_4312 172
8 3300045976 Ga0466967_0393064 Ga0466967_0393064_651_1235 176
9 iso_pu_bacteria 2523231067 2523468421 186
10 iso_pu_bacteria 2738543031 2739348227 186
11 iso_pu_bacteria 2738541297 2738829847 187
12 iso_pu_bacteria 2738541357 2739153643 187
13 iso_pu_bacteria 2738543003 2739195563 187
14 iso_pu_bacteria 2738543026 2739322039 187
15 iso_pu_bacteria 2738543029 2739340280 187
16 iso_pu_bacteria 2842711865 2842715479 187
17 iso_pu_bacteria 2643221645 2644250515 188
18 iso_pu_bacteria 2643221660 2644339572 188
19 iso_pu_bacteria 2643221664 2644358835 188
20 iso_pu_bacteria 2738541280 2738738712 188
21 3300048905 Ga0496102_0018227 Ga0496102_0018227_3717_4295 189
22 3300048913 Ga0496110_0560392 Ga0496110_0560392_108_686 189
23 3300053117 Ga0500593_000692 Ga0500593_000692_6625_7194 189
24 3300021361 Ga0213872_10065757 Ga0213872_100657572 190
25 3300039447 Ga0436361_0709782 Ga0436361_0709782_135_707 190
26 3300048927 Ga0496124_0011069 Ga0496124_0011069_3225_3797 190
27 3300005842 Ga0068858_100101464 Ga0068858_1001014641 191
28 3300025233 Ga0209437_103432 Ga0209437_1034323 191
29 3300025233 Ga0209437_109677 Ga0209437_1096772 191
30 3300025272 Ga0209455_1000043 Ga0209455_1000043352 191
31 3300042134 Ga0450898_012304 Ga0450898_012304_616_1239 191
32 3300042439 Ga0439464_0011368 Ga0439464_0011368_98_721 191
33 3300046460 Ga0495638_0074311 Ga0495638_0074311_680_1255 191
34 3300046460 Ga0495638_0120487 Ga0495638_0120487_408_995 191
35 3300046471 Ga0495650_0000267 Ga0495650_0000267_45578_46165 191
36 3300046471 Ga0495650_0000427 Ga0495650_0000427_4644_5219 191
37 3300046491 Ga0495584_0076321 Ga0495584_0076321_564_1139 191
38 3300046492 Ga0495585_0001650 Ga0495585_0001650_11279_11866 191
39 3300046492 Ga0495585_0008219 Ga0495585_0008219_3408_3983 191
40 3300046501 Ga0495607_0023487 Ga0495607_0023487_3262_3837 191
41 3300046501 Ga0495607_0025546 Ga0495607_0025546_3037_3612 191
42 3300046506 Ga0495583_0000115 Ga0495583_0000115_98569_99144 191
43 3300046512 Ga0495610_0000003 Ga0495610_0000003_908836_909423 191
44 3300046512 Ga0495610_0001513 Ga0495610_0001513_17579_18154 191
45 3300046512 Ga0495610_0007752 Ga0495610_0007752_3978_4553 191
46 3300046513 Ga0495616_0010736 Ga0495616_0010736_4362_4937 191
47 3300046523 Ga0495644_0016078 Ga0495644_0016078_2214_2789 191
48 3300046524 Ga0495648_0012888 Ga0495648_0012888_2436_3011 191
49 3300046524 Ga0495648_0019468 Ga0495648_0019468_2105_2692 191
50 3300046524 Ga0495648_0042431 Ga0495648_0042431_1943_2518 191
51 3300046524 Ga0495648_0063007 Ga0495648_0063007_362_937 191
52 3300046530 Ga0495654_0003468 Ga0495654_0003468_5376_5963 191
53 3300046538 Ga0495609_0001329 Ga0495609_0001329_11685_12260 191
54 3300046538 Ga0495609_0003877 Ga0495609_0003877_3088_3663 191
55 3300046557 Ga0495622_0000001 Ga0495622_0000001_248654_249229 191
56 3300046558 Ga0495633_0000055 Ga0495633_0000055_82916_83491 191
57 3300046558 Ga0495633_0001534 Ga0495633_0001534_16989_17564 191
58 3300046558 Ga0495633_0001714 Ga0495633_0001714_9025_9600 191
59 3300046615 Ga0495656_0001780 Ga0495656_0001780_2883_3458 191
60 3300046616 Ga0495668_0000678 Ga0495668_0000678_26471_27058 191
61 3300046648 Ga0495611_0001239 Ga0495611_0001239_9088_9663 191
62 3300046648 Ga0495611_0003096 Ga0495611_0003096_6604_7179 191
63 3300046660 Ga0495625_0012725 Ga0495625_0012725_5828_6403 191
64 3300046660 Ga0495625_0019615 Ga0495625_0019615_3595_4170 191
65 3300046660 Ga0495625_0092148 Ga0495625_0092148_1454_2041 191
66 3300046664 Ga0495659_0002110 Ga0495659_0002110_5850_6425 191
67 3300046665 Ga0495661_0056385 Ga0495661_0056385_1289_1876 191
68 3300046665 Ga0495661_0326471 Ga0495661_0326471_164_739 191
69 3300046691 Ga0495670_0002367 Ga0495670_0002367_6108_6683 191
70 3300046692 Ga0495671_0000010 Ga0495671_0000010_164818_165405 191
71 3300046692 Ga0495671_0063722 Ga0495671_0063722_335_910 191
72 3300046794 Ga0495589_0399813 Ga0495589_0399813_41_616 191
73 3300046810 Ga0495660_0007526 Ga0495660_0007526_3211_3798 191
74 3300047318 Ga0495636_0000360 Ga0495636_0000360_6073_6648 191
75 3300047323 Ga0495683_0007944 Ga0495683_0007944_3634_4221 191
76 3300047443 Ga0495687_000446 Ga0495687_000446_44985_45560 191
77 3300047445 Ga0495677_0003304 Ga0495677_0003304_1815_2390 191
78 3300047445 Ga0495677_0044405 Ga0495677_0044405_683_1258 191
79 3300047446 Ga0495679_021379 Ga0495679_021379_13_600 191
80 3300047447 Ga0495685_000084 Ga0495685_000084_31398_31973 191
81 3300047469 Ga0495673_0000003 Ga0495673_0000003_1003872_1004447 191
82 3300047469 Ga0495673_0000016 Ga0495673_0000016_283977_284564 191
83 3300047469 Ga0495673_0002371 Ga0495673_0002371_8106_8681 191
84 3300049459 Ga0495678_000549 Ga0495678_000549_6967_7542 191
85 3300049460 Ga0495682_0000328 Ga0495682_0000328_10533_11108 191
86 3300049460 Ga0495682_0000349 Ga0495682_0000349_26380_26955 191
87 3300053125 Ga0500618_000068 Ga0500618_000068_3095_3670 191
88 3300053145 Ga0500586_000143 Ga0500586_000143_4076_4651 191
89 3300053145 Ga0500586_000449 Ga0500586_000449_6708_7295 191
90 3300005339 Ga0070660_100546573 Ga0070660_1005465732 192
91 3300005841 Ga0068863_100197870 Ga0068863_1001978702 192
92 3300006353 Ga0075370_10182965 Ga0075370_101829651 192
93 3300013307 Ga0157372_10014231 Ga0157372_100142318 192
94 3300021361 Ga0213872_10000001 Ga0213872_10000001535 192
95 3300021361 Ga0213872_10000040 Ga0213872_1000004035 192
96 3300021361 Ga0213872_10086842 Ga0213872_100868422 192
97 3300026088 Ga0207641_10302122 Ga0207641_103021222 192
98 3300031665 Ga0316575_10206836 Ga0316575_102068361 192
99 3300037312 Ga0395899_0043994 Ga0395899_0043994_24_611 192
100 3300037418 Ga0395900_0265991 Ga0395900_0265991_171_752 192
101 3300037471 Ga0395905_0050336 Ga0395905_0050336_689_1270 192
102 3300037471 Ga0395905_0255554 Ga0395905_0255554_566_1198 192
103 3300037471 Ga0395905_0923894 Ga0395905_0923894_45_629 192
104 3300038443 Ga0395901_1117821 Ga0395901_1117821_109_696 192
105 3300039447 Ga0436361_0021023 Ga0436361_0021023_3850_4431 192
106 3300039447 Ga0436361_0424705 Ga0436361_0424705_426_1004 192
107 3300039447 Ga0436361_1185928 Ga0436361_1185928_4245_4823 192
108 3300042015 Ga0439462_0028265 Ga0439462_0028265_363_953 192
109 3300042876 Ga0451577_0117443 Ga0451577_0117443_679_1257 192
110 3300042876 Ga0451577_0131023 Ga0451577_0131023_265_843 192
111 3300042876 Ga0451577_0204432 Ga0451577_0204432_498_1076 192
112 3300044712 Ga0453684_1250948 Ga0453684_1250948_73_651 192
113 3300045051 Ga0451576_0048552 Ga0451576_0048552_849_1430 192
114 3300045051 Ga0451576_0097197 Ga0451576_0097197_1890_2468 192
115 3300045051 Ga0451576_1141861 Ga0451576_1141861_226_804 192
116 3300045976 Ga0466967_0235384 Ga0466967_0235384_681_1268 192
117 3300046471 Ga0495650_0000019 Ga0495650_0000019_62798_63376 192
118 3300046506 Ga0495583_0000205 Ga0495583_0000205_49038_49628 192
119 3300046507 Ga0495606_0003462 Ga0495606_0003462_11380_11958 192
120 3300046507 Ga0495606_0035249 Ga0495606_0035249_954_1661 192
121 3300046507 Ga0495606_0053064 Ga0495606_0053064_1460_2164 192
122 3300046522 Ga0495643_0033740 Ga0495643_0033740_20_607 192
123 3300046522 Ga0495643_0144284 Ga0495643_0144284_305_982 192
124 3300046524 Ga0495648_0004796 Ga0495648_0004796_3994_4641 192
125 3300046528 Ga0495642_0079245 Ga0495642_0079245_662_1366 192
126 3300046530 Ga0495654_0030682 Ga0495654_0030682_2110_2688 192
127 3300046538 Ga0495609_0101615 Ga0495609_0101615_347_1051 192
128 3300046542 Ga0495597_0027363 Ga0495597_0027363_1767_2345 192
129 3300046542 Ga0495597_0102767 Ga0495597_0102767_593_1180 192
130 3300046615 Ga0495656_0159483 Ga0495656_0159483_482_1075 192
131 3300046616 Ga0495668_0194492 Ga0495668_0194492_31_705 192
132 3300046660 Ga0495625_0008272 Ga0495625_0008272_4575_5282 192
133 3300046664 Ga0495659_0000049 Ga0495659_0000049_30341_30919 192
134 3300046674 Ga0495588_0084817 Ga0495588_0084817_84_671 192
135 3300046692 Ga0495671_0000498 Ga0495671_0000498_14333_14911 192
136 3300046794 Ga0495589_0071331 Ga0495589_0071331_933_1511 192
137 3300046810 Ga0495660_0000514 Ga0495660_0000514_23706_24410 192
138 3300047320 Ga0495672_0000026 Ga0495672_0000026_26381_26959 192
139 3300047472 Ga0495686_0009399 Ga0495686_0009399_1335_2039 192
140 3300048906 Ga0496103_0087266 Ga0496103_0087266_448_1062 192
141 3300049569 Ga0501032_0037390 Ga0501032_0037390_2028_2615 192
142 3300049571 Ga0501034_0391967 Ga0501034_0391967_299_886 192
143 3300049572 Ga0501036_0328056 Ga0501036_0328056_276_863 192
144 3300049573 Ga0501037_0053284 Ga0501037_0053284_256_843 192
145 3300049574 Ga0501038_0181432 Ga0501038_0181432_651_1238 192
146 3300049578 Ga0501042_0169672 Ga0501042_0169672_272_859 192
147 3300049579 Ga0501043_0069372 Ga0501043_0069372_1435_2022 192
148 3300049581 Ga0501047_0005509 Ga0501047_0005509_7642_8229 192
149 3300049581 Ga0501047_0139696 Ga0501047_0139696_407_994 192
150 3300049586 Ga0501070_0057588 Ga0501070_0057588_2232_2819 192
151 3300049586 Ga0501070_0292790 Ga0501070_0292790_526_1104 192
152 3300049667 Ga0501230_038935 Ga0501230_038935_222_800 192
153 3300049822 Ga0501035_0202488 Ga0501035_0202488_624_1211 192
154 3300049823 Ga0501044_0154184 Ga0501044_0154184_796_1383 192
155 3300050493 nmdc:mga0k408_206544_c1 nmdc:mga0k408_206544_c1_160_750 192
156 3300050496 nmdc:mga07m45_324106_c1 nmdc:mga07m45_324106_c1_245_835 192
157 3300053177 Ga0500636_0235180 Ga0500636_0235180_158_736 192
158 iso_pu_bacteria 2738541300 2738842470 192
159 iso_pu_bacteria 2738543018 2739273217 192
160 iso_pu_bacteria 2738543030 2739342261 192

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07298

NnrU

NnrU protein

3

191

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zdh-assembly1.cif.gz_J complex i from ovis aries at ph7.4, closed state 0.5678 74 182
7v2c-assembly1.cif.gz_m active state complex i from q10 dataset 0.5595 75 179
8c2s-assembly1.cif.gz_J cryo-em structure ndufs4 knockout complex i from mus musculus heart (class 1). 0.5241 74 188
7zme-assembly1.cif.gz_6 cryoem structure of mitochondrial complex i from chaetomium thermophilum (state 2) - membrane arm 0.4949 68 187
6qc8-assembly1.cif.gz_D6 ovine respiratory complex i frc open class 2 0.4761 76 181
ID Description Score Start End Superfamily
af_B4FHU1_131_318_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.6161 2 166 1.20.120.1630
af_Q9ES83_40_267_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.6039 79 149 2.60.120.10
af_Q9UBM1_11_191_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5984 3 149 1.20.120.1630
af_Q23431_78_252_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5892 47 149 1.20.120.1630
af_Q9VZL3_150_302_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.586 53 149 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A7Y0GFU3-F1-model_v4 NnrU family protein 0.9962 1 190 GO:0016020
AF-A0A4Q3N5V1-F1-model_v4 Protein NrnU 0.995 1 192 GO:0016020
AF-N6YL02-F1-model_v4 NnrU domain-containing protein 0.9901 1 192 GO:0016020
AF-R7XPW0-F1-model_v4 NnrU domain-containing protein 0.9881 41 192 GO:0016020
AF-A0A366FWL2-F1-model_v4 Putative membrane protein 0.9875 1 192 GO:0016020

Feature Viewer

pLDDT pTM Quality
96.12 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map