F235099

General Info

Members Datasets Scaffolds Average Seq Length
160 133 320 152

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0852591|Ga0373925_0852591_151_669
Length 172
Sequence MTSSMQRAAGDWDRENATVAYAVTIETAPPRILAAVRRRVHAGEVPRAFRPALDQVWAFLRSNPGLRTDGHNVFHYDHTSGDPATGFDVDFGVEVTRIFAPHGQVACVTTPAGRAALTVHRGAYSGLSAAHAALRHWLDQHGEKIGAWSQEIYGDWHEDESKLETTIAYALA

Samples

Sample ID Description Type Environment
1 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
55 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
72 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
73 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
74 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
75 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
78 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
79 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
80 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
81 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
82 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
83 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
84 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
85 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
86 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
87 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
88 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
89 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
90 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
91 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
94 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
95 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
96 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
97 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
98 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
99 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
100 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
101 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
102 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
103 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
104 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
105 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
106 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
107 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
108 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
109 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
110 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
111 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
112 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
113 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
114 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
115 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
116 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
117 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
118 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
119 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
120 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
121 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
122 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
123 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
124 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
125 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
126 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
127 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
128 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
129 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
130 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
131 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
132 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
133 8002784119 Frankia sp. AgB1.9 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0
Isolates 0.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.25
Nodule 0.62
Rhizoplane 6.88
Rhizosphere 81.88
Stem 0
Stem Tuber 0
Unclassified 28.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373925_0852591 3300037068 Unclassified 751
2 rootH1_10128097 3300003316 Bacteria 1275
3 Ga0065712_10069129 3300005290 Bacteria 7960
4 Ga0065715_10203367 3300005293 Bacteria 1325
5 Ga0070676_11008408 3300005328 Unclassified 625
6 Ga0070683_100009236 3300005329 Bacteria 8422
7 Ga0070670_100214032 3300005331 Bacteria 1676
8 Ga0070670_101005694 3300005331 Unclassified 758
9 Ga0070666_10355550 3300005335 Unclassified 1049
10 Ga0070689_100037964 3300005340 Unclassified 3684
11 Ga0070687_100014278 3300005343 Unclassified 3565
12 Ga0070692_10970447 3300005345 Unclassified 592
13 Ga0070668_100276344 3300005347 Bacteria 1402
14 Ga0070669_100397351 3300005353 Bacteria 1127
15 Ga0070675_100719547 3300005354 Bacteria 910
16 Ga0070673_100219714 3300005364 Unclassified 1644
17 Ga0070673_101269669 3300005364 Unclassified 691
18 Ga0070713_101823770 3300005436 Unclassified 590
19 Ga0070701_10586691 3300005438 Bacteria 736
20 Ga0070708_100158182 3300005445 Bacteria 2110
21 Ga0070685_10120246 3300005466 Unclassified 1630
22 Ga0070706_100072419 3300005467 Bacteria 3189
23 Ga0070706_100596228 3300005467 Bacteria 1027
24 Ga0070698_100005796 3300005471 Bacteria 13506
25 Ga0070699_100136458 3300005518 Bacteria 2164
26 Ga0070684_100004294 3300005535 Bacteria 10816
27 Ga0070665_100516793 3300005548 Unclassified 1206
28 Ga0070664_100321454 3300005564 Unclassified 1402
29 Ga0070702_100115775 3300005615 Bacteria 1670
30 Ga0068864_101799313 3300005618 Unclassified 618
31 Ga0068861_101096820 3300005719 Unclassified 765
32 Ga0068863_100000212 3300005841 Bacteria 62194
33 Ga0068863_101246638 3300005841 Bacteria 750
34 Ga0081540_1014366 3300005983 Bacteria 5074
35 Ga0070717_10007385 3300006028 Bacteria 8161
36 Ga0075365_10055820 3300006038 Bacteria 2623
37 Ga0075363_100005034 3300006048 Bacteria 5848
38 Ga0075364_10013481 3300006051 Bacteria 5026
39 Ga0070715_10204400 3300006163 Unclassified 1005
40 Ga0075367_10011971 3300006178 Bacteria 4608
41 Ga0075367_10240157 3300006178 Bacteria 1135
42 Ga0068871_100112199 3300006358 Bacteria 2294
43 Ga0068871_101177787 3300006358 Unclassified 718
44 Ga0075431_100058110 3300006847 Bacteria 3990
45 Ga0075433_10055309 3300006852 Bacteria 3464
46 Ga0075433_10161148 3300006852 Bacteria 1997
47 Ga0075434_100039477 3300006871 Bacteria 4678
48 Ga0075434_100127352 3300006871 Bacteria 2563
49 Ga0075434_100446769 3300006871 Unclassified 1314
50 Ga0068865_100210404 3300006881 Unclassified 1515
51 Ga0099795_10006471 3300007788 Bacteria 3199
52 Ga0111539_10141015 3300009094 Unclassified 2821
53 Ga0105245_12273668 3300009098 Bacteria 596
54 Ga0114129_12101694 3300009147 Unclassified 681
55 Ga0105248_11665173 3300009177 Unclassified 723
56 Ga0099796_10030783 3300010159 Unclassified 1744
57 Ga0157374_10049252 3300013296 Bacteria 3913
58 Ga0157374_11827815 3300013296 Unclassified 633
59 Ga0157372_11694880 3300013307 Unclassified 727
60 Ga0157375_12977504 3300013308 Unclassified 566
61 Ga0163163_10319067 3300014325 Unclassified 1607
62 Ga0163163_10323109 3300014325 Bacteria 1597
63 Ga0157377_10000059 3300014745 Bacteria 84812
64 Ga0157377_10559857 3300014745 Bacteria 809
65 Ga0157376_10350617 3300014969 Bacteria 1412
66 Ga0157376_10819482 3300014969 Unclassified 944
67 Ga0213872_10074137 3300021361 Bacteria 1532
68 Ga0207426_1017746 3300025302 Bacteria 2523
69 Ga0207684_10235259 3300025910 Bacteria 1580
70 Ga0207662_10022297 3300025918 Unclassified 3629
71 Ga0207650_10302830 3300025925 Bacteria 1306
72 Ga0207659_10534299 3300025926 Bacteria 995
73 Ga0207670_10042219 3300025936 Unclassified 3004
74 Ga0207691_10179383 3300025940 Unclassified 1851
75 Ga0207661_10002084 3300025944 Bacteria 13760
76 Ga0207661_10297234 3300025944 Unclassified 1447
77 Ga0207651_10111541 3300025960 Unclassified 2054
78 Ga0207668_10115144 3300025972 Bacteria 2025
79 Ga0207641_10043266 3300026088 Bacteria 3781
80 Ga0207641_10654826 3300026088 Bacteria 1032
81 Ga0207641_11973129 3300026088 Bacteria 585
82 Ga0207676_11058806 3300026095 Unclassified 801
83 Ga0207675_100057949 3300026118 Bacteria 3615
84 Ga0207428_10067271 3300027907 Unclassified 2821
85 Ga0268266_10639991 3300028379 Bacteria 1023
86 Ga0268264_10353198 3300028381 Bacteria 1400
87 Ga0265337_1184163 3300028556 Bacteria 567
88 Ga0265334_10025872 3300028573 Bacteria 2373
89 Ga0265318_10004292 3300028577 Bacteria 6941
90 Ga0265318_10025173 3300028577 Bacteria 2353
91 Ga0265318_10099353 3300028577 Bacteria 1071
92 Ga0265318_10163515 3300028577 Bacteria 816
93 Ga0265322_10019669 3300028654 Bacteria 1937
94 Ga0265322_10094658 3300028654 Bacteria 849
95 Ga0265336_10006172 3300028666 Bacteria 4339
96 Ga0265338_10411812 3300028800 Bacteria 962
97 Ga0265324_10008204 3300029957 Bacteria 4168
98 Ga0265332_10030821 3300031238 Bacteria 2341
99 Ga0265320_10001970 3300031240 Bacteria 14512
100 Ga0265320_10411436 3300031240 Unclassified 597
101 Ga0265325_10037838 3300031241 Bacteria 2549
102 Ga0265329_10055095 3300031242 Unclassified 1262
103 Ga0265340_10217521 3300031247 Unclassified 856
104 Ga0265331_10019737 3300031250 Bacteria 3475
105 Ga0265316_10123062 3300031344 Unclassified 1958
106 Ga0265316_10147044 3300031344 Bacteria 1767
107 Ga0265314_10004053 3300031711 Bacteria 13831
108 Ga0265342_10150256 3300031712 Unclassified 1294
109 Ga0373934_0102774 3300035086 Bacteria 1155
110 Ga0373924_0450772 3300035410 Unclassified 577
111 Ga0373931_0037630 3300035691 Bacteria 2526
112 Ga0373935_0138878 3300035692 Bacteria 1640
113 Ga0373933_0000577 3300035724 Bacteria 23008
114 Ga0373937_0028339 3300036401 Bacteria 5066
115 Ga0436360_0942585 3300039438 Bacteria 2910
116 Ga0436363_0489938 3300039450 Unclassified 1521
117 Ga0436362_0202663 3300039453 Bacteria 637
118 Ga0495603_0152419 3300046455 Bacteria 1342
119 Ga0495664_0096140 3300046477 Bacteria 1783
120 Ga0495628_0107063 3300046516 Bacteria 2153
121 Ga0495652_0112414 3300046529 Bacteria 2188
122 Ga0495586_0037233 3300046535 Bacteria 2611
123 Ga0495634_0001185 3300046642 Bacteria 24146
124 Ga0495625_0074322 3300046660 Bacteria 2381
125 Ga0495674_0000171 3300047319 Bacteria 50686
126 Ga0495686_0000013 3300047472 Bacteria 489656
127 Ga0496100_0044933 3300048903 Bacteria 2832
128 Ga0496102_0066700 3300048905 Bacteria 3299
129 Ga0496102_0356406 3300048905 Bacteria 1377
130 Ga0496106_0258209 3300048909 Bacteria 1394
131 Ga0496106_0364556 3300048909 Unclassified 1161
132 Ga0496108_0062884 3300048911 Bacteria 3125
133 Ga0496109_0273090 3300048912 Bacteria 1593
134 Ga0496110_0190642 3300048913 Unclassified 1862
135 Ga0496114_0042658 3300048917 Bacteria 3761
136 Ga0496114_0549735 3300048917 Bacteria 1020
137 Ga0496115_0220071 3300048918 Bacteria 1567
138 Ga0496116_0000344 3300048919 Bacteria 73966
139 Ga0496117_0012491 3300048920 Bacteria 7478
140 Ga0496118_0035905 3300048921 Bacteria 4016
141 Ga0496119_0002609 3300048922 Bacteria 19558
142 Ga0496120_0151926 3300048923 Bacteria 1163
143 Ga0501070_0073808 3300049586 Bacteria 2823
144 Ga0501071_0549950 3300049587 Bacteria 887
145 Ga0501073_0016683 3300049589 Bacteria 5321
146 Ga0501080_0532020 3300049742 Bacteria 1048
147 Ga0501083_0008172 3300049744 Bacteria 7402
148 nmdc:mga03n38_23073_c1 3300050490 Bacteria 2527
149 nmdc:mga0yw44_48281_c1 3300050492 Bacteria 2566
150 nmdc:mga06z11_13426_c1 3300050494 Bacteria 3597
151 nmdc:mga06z11_6572_c2 3300050494 Bacteria 3662
152 nmdc:mga05p37_414083_c1 3300050507 Bacteria 1570
153 nmdc:mga06r32_72197_c1 3300050510 Bacteria 3341
154 nmdc:mga08y16_395228_c1 3300050511 Unclassified 1416
155 nmdc:mga0n895_26604_c1 3300050512 Bacteria 5482
156 nmdc:mga0a205_102030_c1 3300050515 Unclassified 2768
157 nmdc:mga0a205_127539_c1 3300050515 Bacteria 2444
158 Ga0495601_0045349 3300053077 Bacteria 2764
159 Ga0501082_0403020 3300060353 Bacteria 1194
160 8002787900 8002784119 Bacteria 9788632
161 Ga0373925_0852591
162 rootH1_10128097
163 Ga0065712_10069129
164 Ga0065715_10203367
165 Ga0070676_11008408
166 Ga0070683_100009236
167 Ga0070670_100214032
168 Ga0070670_101005694
169 Ga0070666_10355550
170 Ga0070689_100037964
171 Ga0070687_100014278
172 Ga0070692_10970447
173 Ga0070668_100276344
174 Ga0070669_100397351
175 Ga0070675_100719547
176 Ga0070673_100219714
177 Ga0070673_101269669
178 Ga0070713_101823770
179 Ga0070701_10586691
180 Ga0070708_100158182
181 Ga0070685_10120246
182 Ga0070706_100072419
183 Ga0070706_100596228
184 Ga0070698_100005796
185 Ga0070699_100136458
186 Ga0070684_100004294
187 Ga0070665_100516793
188 Ga0070664_100321454
189 Ga0070702_100115775
190 Ga0068864_101799313
191 Ga0068861_101096820
192 Ga0068863_100000212
193 Ga0068863_101246638
194 Ga0081540_1014366
195 Ga0070717_10007385
196 Ga0075365_10055820
197 Ga0075363_100005034
198 Ga0075364_10013481
199 Ga0070715_10204400
200 Ga0075367_10011971
201 Ga0075367_10240157
202 Ga0068871_100112199
203 Ga0068871_101177787
204 Ga0075431_100058110
205 Ga0075433_10055309
206 Ga0075433_10161148
207 Ga0075434_100039477
208 Ga0075434_100127352
209 Ga0075434_100446769
210 Ga0068865_100210404
211 Ga0099795_10006471
212 Ga0111539_10141015
213 Ga0105245_12273668
214 Ga0114129_12101694
215 Ga0105248_11665173
216 Ga0099796_10030783
217 Ga0157374_10049252
218 Ga0157374_11827815
219 Ga0157372_11694880
220 Ga0157375_12977504
221 Ga0163163_10319067
222 Ga0163163_10323109
223 Ga0157377_10000059
224 Ga0157377_10559857
225 Ga0157376_10350617
226 Ga0157376_10819482
227 Ga0213872_10074137
228 Ga0207426_1017746
229 Ga0207684_10235259
230 Ga0207662_10022297
231 Ga0207650_10302830
232 Ga0207659_10534299
233 Ga0207670_10042219
234 Ga0207691_10179383
235 Ga0207661_10002084
236 Ga0207661_10297234
237 Ga0207651_10111541
238 Ga0207668_10115144
239 Ga0207641_10043266
240 Ga0207641_10654826
241 Ga0207641_11973129
242 Ga0207676_11058806
243 Ga0207675_100057949
244 Ga0207428_10067271
245 Ga0268266_10639991
246 Ga0268264_10353198
247 Ga0265337_1184163
248 Ga0265334_10025872
249 Ga0265318_10004292
250 Ga0265318_10025173
251 Ga0265318_10099353
252 Ga0265318_10163515
253 Ga0265322_10019669
254 Ga0265322_10094658
255 Ga0265336_10006172
256 Ga0265338_10411812
257 Ga0265324_10008204
258 Ga0265332_10030821
259 Ga0265320_10001970
260 Ga0265320_10411436
261 Ga0265325_10037838
262 Ga0265329_10055095
263 Ga0265340_10217521
264 Ga0265331_10019737
265 Ga0265316_10123062
266 Ga0265316_10147044
267 Ga0265314_10004053
268 Ga0265342_10150256
269 Ga0373934_0102774
270 Ga0373924_0450772
271 Ga0373931_0037630
272 Ga0373935_0138878
273 Ga0373933_0000577
274 Ga0373937_0028339
275 Ga0436360_0942585
276 Ga0436363_0489938
277 Ga0436362_0202663
278 Ga0495603_0152419
279 Ga0495664_0096140
280 Ga0495628_0107063
281 Ga0495652_0112414
282 Ga0495586_0037233
283 Ga0495634_0001185
284 Ga0495625_0074322
285 Ga0495674_0000171
286 Ga0495686_0000013
287 Ga0496100_0044933
288 Ga0496102_0066700
289 Ga0496102_0356406
290 Ga0496106_0258209
291 Ga0496106_0364556
292 Ga0496108_0062884
293 Ga0496109_0273090
294 Ga0496110_0190642
295 Ga0496114_0042658
296 Ga0496114_0549735
297 Ga0496115_0220071
298 Ga0496116_0000344
299 Ga0496117_0012491
300 Ga0496118_0035905
301 Ga0496119_0002609
302 Ga0496120_0151926
303 Ga0501070_0073808
304 Ga0501071_0549950
305 Ga0501073_0016683
306 Ga0501080_0532020
307 Ga0501083_0008172
308 nmdc:mga03n38_23073_c1
309 nmdc:mga0yw44_48281_c1
310 nmdc:mga06z11_13426_c1
311 nmdc:mga06z11_6572_c2
312 nmdc:mga05p37_414083_c1
313 nmdc:mga06r32_72197_c1
314 nmdc:mga08y16_395228_c1
315 nmdc:mga0n895_26604_c1
316 nmdc:mga0a205_102030_c1
317 nmdc:mga0a205_127539_c1
318 Ga0495601_0045349
319 Ga0501082_0403020
320 8002787900

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06445

GyrI-like

GyrI-like small molecule binding domain

21

171

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kax-assembly1.cif.gz_A the structure of ctr107 protein bound to rhodamine 6g 0.8479 4 153
6xl6-assembly1.cif.gz_H cryo-em structure of ecmrr-dna complex in ecmrr-rpo 0.8431 3 153
6xl6-assembly1.cif.gz_H cryo-em structure of ecmrr-dna complex in ecmrr-rpo 0.8282 3 153
5kax-assembly1.cif.gz_A the structure of ctr107 protein bound to rhodamine 6g 0.8231 4 153
6wl5-assembly4.cif.gz_D crystal structure of ecmrr c-terminal domain 0.8229 1 153
ID Description Score Start End Superfamily
3e0hA00 Alpha Beta;Alpha-Beta Barrel;Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A;Regulatory factor, effector binding domain 0.8679 2 153 3.20.80.10
3e0hA00 Alpha Beta;Alpha-Beta Barrel;Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A;Regulatory factor, effector binding domain 0.8573 2 153 3.20.80.10
af_Q46866_6_160_3.20.80.10 Alpha Beta;Alpha-Beta Barrel;Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A;Regulatory factor, effector binding domain 0.7542 4 153 3.20.80.10
af_F1QJ51_31_224_3.20.80.10 Alpha Beta;Alpha-Beta Barrel;Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A;Regulatory factor, effector binding domain 0.7501 5 153 3.20.80.10
af_Q46866_6_160_3.20.80.10 Alpha Beta;Alpha-Beta Barrel;Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A;Regulatory factor, effector binding domain 0.7371 4 153 3.20.80.10
ID Description Score Start End GO Terms
AF-A0A1S1RS45-F1-model_v4 deleted 0.9888 2 153
AF-A0A2V8DG23-F1-model_v4 Bacterial transcription activator effector binding domain-containing protein 0.979 1 153
AF-A0A7V8NPY3-F1-model_v4 GyrI-like domain-containing protein 0.9789 1 136
AF-A0A1S1RS45-F1-model_v4 deleted 0.9761 2 153
AF-A0A2V8DG23-F1-model_v4 Bacterial transcription activator effector binding domain-containing protein 0.9727 1 153

Map