F234771

General Info

Members Datasets Scaffolds Average Seq Length
160 121 320 131

Family's Representative Sequence

Representative Sequence 3300025929|Ga0207664_10178315|Ga0207664_101783153
Length 130
Sequence MKTTVGALTLFVADKERAKAFYGRAFELEPVFEDDNSVVFKFDNTLINLLVETEAPELIAPAAVGTGTRAQFTIWVDDVDAEHASLRGRGVEVLNGPQDRPWGQRTVALADPDGHVWEIAQELGQAEKPA

Samples

Sample ID Description Type Environment
1 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
45 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
49 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
50 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
51 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
67 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
68 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
69 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
70 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
71 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
72 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
73 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
74 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
75 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
76 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
77 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
78 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
79 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
80 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
81 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
82 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
83 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
84 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
85 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
86 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
87 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
88 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
89 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
90 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
91 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
92 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
93 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
94 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
95 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
96 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
97 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
98 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
99 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
100 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
101 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
102 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
103 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
104 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
105 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
106 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
107 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
108 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
109 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
110 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
111 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
112 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
113 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
114 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
115 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
116 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
117 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
118 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
119 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
120 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
121 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.12
Metatranscriptomes 1.88
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.38
Rhizosphere 92.5
Stem 0
Stem Tuber 0
Unclassified 5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207664_10178315 3300025929 Bacteria 1823
2 Ga0070658_10387659 3300005327 Bacteria 1199
3 Ga0070683_102372885 3300005329 Bacteria 509
4 Ga0070680_100896987 3300005336 Bacteria 765
5 Ga0070682_100301999 3300005337 Bacteria 1175
6 Ga0070673_102010327 3300005364 Bacteria 549
7 Ga0070688_100288613 3300005365 Bacteria 1182
8 Ga0070709_10850326 3300005434 Bacteria 719
9 Ga0070713_100848122 3300005436 Bacteria 877
10 Ga0070711_101196987 3300005439 Bacteria 657
11 Ga0070705_101301295 3300005440 Bacteria 603
12 Ga0070678_100961960 3300005456 Bacteria 783
13 Ga0070662_101085008 3300005457 Bacteria 687
14 Ga0070681_10759613 3300005458 Bacteria 886
15 Ga0068867_100800878 3300005459 Bacteria 840
16 Ga0070685_10521710 3300005466 Bacteria 844
17 Ga0070679_101030435 3300005530 Bacteria 767
18 Ga0070684_100000816 3300005535 Bacteria 21766
19 Ga0070684_100014440 3300005535 Bacteria 6399
20 Ga0070684_100328627 3300005535 Bacteria 1405
21 Ga0068855_100800144 3300005563 Bacteria 1002
22 Ga0068857_100021154 3300005577 Bacteria 5724
23 Ga0068857_100131911 3300005577 Bacteria 2253
24 Ga0068856_100864061 3300005614 Unclassified 924
25 Ga0068856_101378272 3300005614 Bacteria 720
26 Ga0068861_100872480 3300005719 Bacteria 850
27 Ga0068862_101918350 3300005844 Bacteria 602
28 Ga0081455_10481314 3300005937 Bacteria 839
29 Ga0081540_1001287 3300005983 Bacteria 21912
30 Ga0070712_100276097 3300006175 Bacteria 1352
31 Ga0068871_100778638 3300006358 Archaea 881
32 Ga0075433_10066651 3300006852 Bacteria 3159
33 Ga0075433_10138619 3300006852 Bacteria 2162
34 Ga0075434_101447255 3300006871 Bacteria 697
35 Ga0105245_10144638 3300009098 Bacteria 2242
36 Ga0105242_10057939 3300009176 Bacteria 3174
37 Ga0105238_12352785 3300009551 Bacteria 568
38 Ga0105249_10307562 3300009553 Bacteria 1592
39 Ga0105239_10370911 3300010375 Bacteria 1617
40 Ga0105246_10118198 3300011119 Bacteria 1960
41 Ga0157373_10060452 3300013100 Bacteria 2684
42 Ga0157373_10065063 3300013100 Bacteria 2580
43 Ga0157371_10428400 3300013102 Bacteria 970
44 Ga0157369_10146880 3300013105 Bacteria 2493
45 Ga0157369_11521320 3300013105 Bacteria 681
46 Ga0157369_11887683 3300013105 Bacteria 606
47 Ga0157374_11520416 3300013296 Bacteria 693
48 Ga0157372_11917843 3300013307 Bacteria 681
49 Ga0157375_10621547 3300013308 Bacteria 1238
50 Ga0163163_12239972 3300014325 Bacteria 605
51 Ga0157380_12169439 3300014326 Bacteria 619
52 Ga0182008_10004493 3300014497 Bacteria 8147
53 Ga0182008_10039261 3300014497 Bacteria 2366
54 Ga0157377_10485320 3300014745 Bacteria 860
55 Ga0157379_11031757 3300014968 Bacteria 785
56 Ga0157376_11225618 3300014969 Bacteria 779
57 Ga0182006_1007525 3300015261 Bacteria 4978
58 Ga0182007_10007225 3300015262 Bacteria 4679
59 Ga0182005_1097484 3300015265 Bacteria 821
60 Ga0206356_11357113 3300020070 Unclassified 886
61 Ga0206354_11482006 3300020081 Bacteria 6992
62 Ga0206353_11891789 3300020082 Bacteria 6935
63 Ga0207647_10172121 3300025904 Bacteria 1260
64 Ga0207699_10903633 3300025906 Bacteria 651
65 Ga0207705_10876542 3300025909 Bacteria 696
66 Ga0207707_10584500 3300025912 Bacteria 946
67 Ga0207693_10516369 3300025915 Bacteria 932
68 Ga0207690_11343642 3300025932 Bacteria 597
69 Ga0207686_10522146 3300025934 Bacteria 924
70 Ga0207709_10297672 3300025935 Unclassified 1198
71 Ga0207702_11859835 3300026078 Bacteria 593
72 Ga0207648_10260125 3300026089 Bacteria 1548
73 Ga0207674_10001139 3300026116 Bacteria 34497
74 Ga0207674_11312203 3300026116 Bacteria 693
75 Ga0207683_10173223 3300026121 Bacteria 1955
76 Ga0265314_10387615 3300031711 Bacteria 759
77 Ga0373931_0765778 3300035691 Bacteria 642
78 Ga0373925_1086608 3300037068 Bacteria 658
79 Ga0395899_0018229 3300037312 Bacteria 5340
80 Ga0395899_0731458 3300037312 Bacteria 618
81 Ga0395900_0025982 3300037418 Bacteria 5996
82 Ga0395900_0061998 3300037418 Bacteria 3844
83 Ga0395898_0058951 3300037466 Bacteria 3736
84 Ga0395898_0082569 3300037466 Bacteria 3097
85 Ga0395898_0097601 3300037466 Bacteria 2822
86 Ga0395898_0375274 3300037466 Bacteria 1356
87 Ga0395905_0012677 3300037471 Bacteria 8110
88 Ga0395905_0423700 3300037471 Bacteria 1227
89 Ga0395905_0443661 3300037471 Bacteria 1195
90 Ga0395905_0706796 3300037471 Unclassified 910
91 Ga0395901_0006482 3300038443 Bacteria 11847
92 Ga0395901_0009750 3300038443 Bacteria 9737
93 Ga0395901_0188520 3300038443 Bacteria 2163
94 Ga0395901_0342805 3300038443 Bacteria 1543
95 Ga0451853_3231837 3300041512 Bacteria 1596
96 Ga0466965_0115123 3300044683 Bacteria 1385
97 Ga0466961_0183945 3300044693 Bacteria 1297
98 Ga0466961_0497751 3300044693 Bacteria 736
99 Ga0466963_0015435 3300044694 Bacteria 4730
100 Ga0466963_0044955 3300044694 Bacteria 2907
101 Ga0466963_0091641 3300044694 Bacteria 2070
102 Ga0466963_0164346 3300044694 Bacteria 1546
103 Ga0466963_0679159 3300044694 Bacteria 727
104 Ga0466963_0689242 3300044694 Unclassified 721
105 Ga0466964_0122583 3300044706 Bacteria 1174
106 Ga0466971_0178499 3300044719 Bacteria 998
107 Ga0466957_0147830 3300044842 Bacteria 1518
108 Ga0466957_0484019 3300044842 Bacteria 856
109 Ga0451576_0276733 3300045051 Bacteria 1755
110 Ga0466958_0012058 3300045836 Bacteria 4885
111 Ga0466958_0033641 3300045836 Bacteria 3055
112 Ga0466967_0011587 3300045976 Bacteria 6692
113 Ga0466967_0015532 3300045976 Bacteria 5970
114 Ga0466967_0036408 3300045976 Bacteria 4201
115 Ga0466967_0058395 3300045976 Bacteria 3410
116 Ga0466967_0319864 3300045976 Bacteria 1496
117 Ga0466967_0466634 3300045976 Bacteria 1235
118 Ga0495627_078738 3300046453 Bacteria 957
119 Ga0495592_0386923 3300046454 Bacteria 889
120 Ga0495582_0120298 3300046473 Bacteria 1479
121 Ga0495582_0703202 3300046473 Bacteria 585
122 Ga0495605_0425729 3300046474 Bacteria 549
123 Ga0495596_0045140 3300046500 Bacteria 1733
124 Ga0495596_0243800 3300046500 Bacteria 698
125 Ga0495620_0417314 3300046515 Bacteria 508
126 Ga0495663_0132906 3300046525 Bacteria 840
127 Ga0495665_0585407 3300046531 Bacteria 558
128 Ga0495586_0193758 3300046535 Bacteria 1151
129 Ga0495609_0079957 3300046538 Bacteria 1430
130 Ga0495656_0018175 3300046615 Bacteria 2695
131 Ga0495634_0383688 3300046642 Bacteria 837
132 Ga0495659_0070416 3300046664 Unclassified 1309
133 Ga0495599_0445640 3300046678 Unclassified 767
134 Ga0495613_0176286 3300046689 Bacteria 1515
135 Ga0495589_0283892 3300046794 Unclassified 769
136 Ga0495581_0121616 3300047315 Bacteria 1519
137 Ga0495636_0098218 3300047318 Bacteria 1278
138 Ga0495674_1093422 3300047319 Bacteria 607
139 Ga0495676_0123906 3300047321 Bacteria 1876
140 Ga0495680_0477856 3300047322 Bacteria 849
141 Ga0496109_1196165 3300048912 Bacteria 697
142 Ga0496110_0032852 3300048913 Bacteria 4486
143 Ga0496110_1443505 3300048913 Bacteria 598
144 Ga0496111_0042103 3300048914 Bacteria 3279
145 Ga0496111_0270773 3300048914 Bacteria 1260
146 Ga0496112_0094812 3300048915 Bacteria 2955
147 Ga0496113_0880555 3300048916 Bacteria 709
148 Ga0496118_0187184 3300048921 Bacteria 1243
149 Ga0496121_0204144 3300048924 Bacteria 1406
150 Ga0496122_0154969 3300048925 Bacteria 1407
151 Ga0496124_0000133 3300048927 Bacteria 154328
152 Ga0501067_0076346 3300049583 Bacteria 1856
153 Ga0501069_0173779 3300049585 Bacteria 1243
154 Ga0501077_0001713 3300049593 Bacteria 13220
155 nmdc:mga0n895_1857990_c1 3300050512 Bacteria 562
156 nmdc:mga0a205_26760_c1 3300050515 Bacteria 5503
157 nmdc:mga0a205_288672_c1 3300050515 Bacteria 1515
158 Ga0495655_0150146 3300053083 Bacteria 732
159 Ga0466962_0581305 3300061719 Bacteria 570
160 Ga0530510_1390374 3300061734 Bacteria 539
161 Ga0207664_10178315
162 Ga0070658_10387659
163 Ga0070683_102372885
164 Ga0070680_100896987
165 Ga0070682_100301999
166 Ga0070673_102010327
167 Ga0070688_100288613
168 Ga0070709_10850326
169 Ga0070713_100848122
170 Ga0070711_101196987
171 Ga0070705_101301295
172 Ga0070678_100961960
173 Ga0070662_101085008
174 Ga0070681_10759613
175 Ga0068867_100800878
176 Ga0070685_10521710
177 Ga0070679_101030435
178 Ga0070684_100000816
179 Ga0070684_100014440
180 Ga0070684_100328627
181 Ga0068855_100800144
182 Ga0068857_100021154
183 Ga0068857_100131911
184 Ga0068856_100864061
185 Ga0068856_101378272
186 Ga0068861_100872480
187 Ga0068862_101918350
188 Ga0081455_10481314
189 Ga0081540_1001287
190 Ga0070712_100276097
191 Ga0068871_100778638
192 Ga0075433_10066651
193 Ga0075433_10138619
194 Ga0075434_101447255
195 Ga0105245_10144638
196 Ga0105242_10057939
197 Ga0105238_12352785
198 Ga0105249_10307562
199 Ga0105239_10370911
200 Ga0105246_10118198
201 Ga0157373_10060452
202 Ga0157373_10065063
203 Ga0157371_10428400
204 Ga0157369_10146880
205 Ga0157369_11521320
206 Ga0157369_11887683
207 Ga0157374_11520416
208 Ga0157372_11917843
209 Ga0157375_10621547
210 Ga0163163_12239972
211 Ga0157380_12169439
212 Ga0182008_10004493
213 Ga0182008_10039261
214 Ga0157377_10485320
215 Ga0157379_11031757
216 Ga0157376_11225618
217 Ga0182006_1007525
218 Ga0182007_10007225
219 Ga0182005_1097484
220 Ga0206356_11357113
221 Ga0206354_11482006
222 Ga0206353_11891789
223 Ga0207647_10172121
224 Ga0207699_10903633
225 Ga0207705_10876542
226 Ga0207707_10584500
227 Ga0207693_10516369
228 Ga0207690_11343642
229 Ga0207686_10522146
230 Ga0207709_10297672
231 Ga0207702_11859835
232 Ga0207648_10260125
233 Ga0207674_10001139
234 Ga0207674_11312203
235 Ga0207683_10173223
236 Ga0265314_10387615
237 Ga0373931_0765778
238 Ga0373925_1086608
239 Ga0395899_0018229
240 Ga0395899_0731458
241 Ga0395900_0025982
242 Ga0395900_0061998
243 Ga0395898_0058951
244 Ga0395898_0082569
245 Ga0395898_0097601
246 Ga0395898_0375274
247 Ga0395905_0012677
248 Ga0395905_0423700
249 Ga0395905_0443661
250 Ga0395905_0706796
251 Ga0395901_0006482
252 Ga0395901_0009750
253 Ga0395901_0188520
254 Ga0395901_0342805
255 Ga0451853_3231837
256 Ga0466965_0115123
257 Ga0466961_0183945
258 Ga0466961_0497751
259 Ga0466963_0015435
260 Ga0466963_0044955
261 Ga0466963_0091641
262 Ga0466963_0164346
263 Ga0466963_0679159
264 Ga0466963_0689242
265 Ga0466964_0122583
266 Ga0466971_0178499
267 Ga0466957_0147830
268 Ga0466957_0484019
269 Ga0451576_0276733
270 Ga0466958_0012058
271 Ga0466958_0033641
272 Ga0466967_0011587
273 Ga0466967_0015532
274 Ga0466967_0036408
275 Ga0466967_0058395
276 Ga0466967_0319864
277 Ga0466967_0466634
278 Ga0495627_078738
279 Ga0495592_0386923
280 Ga0495582_0120298
281 Ga0495582_0703202
282 Ga0495605_0425729
283 Ga0495596_0045140
284 Ga0495596_0243800
285 Ga0495620_0417314
286 Ga0495663_0132906
287 Ga0495665_0585407
288 Ga0495586_0193758
289 Ga0495609_0079957
290 Ga0495656_0018175
291 Ga0495634_0383688
292 Ga0495659_0070416
293 Ga0495599_0445640
294 Ga0495613_0176286
295 Ga0495589_0283892
296 Ga0495581_0121616
297 Ga0495636_0098218
298 Ga0495674_1093422
299 Ga0495676_0123906
300 Ga0495680_0477856
301 Ga0496109_1196165
302 Ga0496110_0032852
303 Ga0496110_1443505
304 Ga0496111_0042103
305 Ga0496111_0270773
306 Ga0496112_0094812
307 Ga0496113_0880555
308 Ga0496118_0187184
309 Ga0496121_0204144
310 Ga0496122_0154969
311 Ga0496124_0000133
312 Ga0501067_0076346
313 Ga0501069_0173779
314 Ga0501077_0001713
315 nmdc:mga0n895_1857990_c1
316 nmdc:mga0a205_26760_c1
317 nmdc:mga0a205_288672_c1
318 Ga0495655_0150146
319 Ga0466962_0581305
320 Ga0530510_1390374

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

4

119

0.95

PF18029

Glyoxalase_6

Glyoxalase-like domain

7

120

0.86

PF12681

Glyoxalase_2

Glyoxalase-like domain

5

124

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nb1-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.80 angstrom resolution with l-cysteine-cys9 disulfide 0.8444 9 135
2i7r-assembly1.cif.gz_B conserved domain protein 0.8335 11 132
4nb0-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution 0.8325 9 135
2rbb-assembly1.cif.gz_B crystal structure of a glyoxalase/bleomycin resistance protein/dioxygenase family enzyme from burkholderia phytofirmans psjn 0.8318 13 133
3bqx-assembly1.cif.gz_A-2 high resolution crystal structure of a glyoxalase-related enzyme from fulvimarina pelagi 0.8254 9 132
ID Description Score Start End Superfamily
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8941 81 133 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8828 80 135 3.30.720.110
2kjzB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8693 14 60 3.30.720.120
3sk1C01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8587 13 57 3.30.720.120
3bt3B02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.853 77 133 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A6B2URD7-F1-model_v4 VOC family protein 0.9203 13 130
AF-A0A3N2DAD2-F1-model_v4 Catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme 0.9201 9 133 GO:0016829
GO:0051213
AF-A0A7V9MBD2-F1-model_v4 VOC family protein 0.9193 11 131
AF-A0A4V1BEF9-F1-model_v4 VOC family protein 0.9185 13 130
AF-A0A0T1WP78-F1-model_v4 Glyoxalase 0.9159 9 134

Map