F233390

General Info

Members Datasets Scaffolds Average Seq Length
159 143 318 204

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|3006425503|3006428786
Length 225
Sequence RTTPREPESGDAAAPSGEVRIEHLVTSGTFSLDGSTFEVDNNVWLVGDDREVYVIDAAHDAEAILAAVGDRRLLGVISTHGHDDHIDAAPEVAERAGAPVLLHPEDRVLWDMRHPERAPDGPLADGDTLTVGSTDLGVLHTPGHSPGAICLYAPSLATVFSGDTLFQGGPGATGRSYSSFPLIIDSIRDRLLTLPPETVVRTGHGDMTTIGAEAPHLEEWIARGH

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
21 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
22 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
23 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
24 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
25 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
26 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
27 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
36 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
37 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
38 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
39 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
40 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
41 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
42 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
43 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
44 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
45 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
46 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
47 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
48 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
49 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
50 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
51 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
52 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
53 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
54 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
55 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
56 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
57 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
58 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
59 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
60 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
61 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
62 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
63 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
64 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
65 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
66 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
67 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
68 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
69 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
70 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
71 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
72 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
73 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
74 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
75 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
76 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
77 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
78 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
79 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
80 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
81 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
82 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
83 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
94 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
95 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
97 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
98 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
99 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
100 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
101 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
102 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
103 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
104 2643221647 Streptomyces sp. Root369 Isolate Unclassified
105 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
106 2643221714 Streptomyces sp. Root264 Isolate Unclassified
107 2671180195 Frankia sp. CcI49 Isolate Nodule
108 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
109 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
110 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
111 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
112 2687453737 Frankia sp. BMG5.36 Isolate Nodule
113 2773857922 Frankia sp. CcI49 Isolate Nodule
114 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
115 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
116 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
117 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
118 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
119 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
120 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
121 2867369537 Streptomyces sp. Z26 Isolate Unclassified
122 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
123 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
124 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
125 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
126 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
127 2891562705 Microbispora tritici MT50 Isolate Unclassified
128 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
129 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
130 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
131 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
132 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
133 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
134 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
135 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
136 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
137 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
138 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
139 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
140 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
141 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
142 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
143 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 72.33
Metatranscriptomes 0
Isolates 27.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.77
Nodule 4.4
Rhizoplane 1.26
Rhizosphere 69.81
Stem 0
Stem Tuber 0.63
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10054223 3300001989 Bacteria 1285
2 JGI24735J21928_10034598 3300002067 Bacteria 1489
3 JGI24738J21930_10012470 3300002075 Bacteria 1857
4 JGI25406J46586_10001445 3300003203 Bacteria 11207
5 rootH2_10063368 3300003320 Bacteria 1049
6 rootL2_10053404 3300003322 Bacteria 1894
7 JGI25160J50197_1026865 3300003354 Bacteria 1578
8 Ga0065714_10069351 3300005288 Bacteria 4260
9 Ga0070658_10273485 3300005327 Bacteria 1437
10 Ga0070668_100140599 3300005347 Bacteria 1945
11 Ga0070714_100000006 3300005435 Bacteria 293311
12 Ga0070710_10390964 3300005437 Bacteria 930
13 Ga0070698_100168293 3300005471 Bacteria 2133
14 Ga0070699_100776891 3300005518 Bacteria 876
15 Ga0070693_100684603 3300005547 Bacteria 749
16 Ga0070664_100373307 3300005564 Bacteria 1301
17 Ga0068856_100297249 3300005614 Bacteria 1632
18 Ga0081455_10000123 3300005937 Bacteria 89254
19 Ga0081539_10000254 3300005985 Bacteria 123532
20 Ga0099826_10142915 3300006948 Bacteria 1379
21 Ga0105238_10293829 3300009551 Bacteria 1607
22 Ga0105246_10198879 3300011119 Bacteria 1557
23 Ga0105246_11024104 3300011119 Bacteria 749
24 Ga0157369_10467210 3300013105 Bacteria 1306
25 Ga0157372_10350490 3300013307 Bacteria 1720
26 Ga0182007_10002230 3300015262 Bacteria 9801
27 Ga0207426_1004446 3300025302 Bacteria 6836
28 Ga0207426_1009157 3300025302 Bacteria 3937
29 Ga0207692_10331326 3300025898 Bacteria 934
30 Ga0207647_10022335 3300025904 Bacteria 4204
31 Ga0207707_10590835 3300025912 Bacteria 940
32 Ga0207694_10110974 3300025924 Bacteria 2182
33 Ga0207694_10280070 3300025924 Bacteria 1370
34 Ga0207664_10000032 3300025929 Bacteria 179232
35 Ga0207679_10511816 3300025945 Bacteria 1072
36 Ga0207668_10015594 3300025972 Bacteria 4724
37 Ga0207668_10281436 3300025972 Bacteria 1364
38 Ga0207702_10436904 3300026078 Bacteria 1268
39 Ga0307517_10182207 3300028786 Bacteria 1353
40 Ga0307515_10246911 3300028794 Bacteria 1545
41 Ga0307513_10004144 3300031456 Bacteria 19417
42 Ga0307508_10003098 3300031616 Bacteria 17069
43 Ga0307518_10294060 3300031838 Bacteria 993
44 Ga0395898_0002672 3300037466 Bacteria 20661
45 Ga0395905_0748328 3300037471 Bacteria 880
46 Ga0436364_0281980 3300037853 Bacteria 747
47 Ga0395901_0030134 3300038443 Bacteria 5589
48 Ga0395901_0059991 3300038443 Bacteria 3958
49 Ga0439436_0010993 3300041404 Bacteria 2753
50 Ga0451839_1479651 3300041496 Bacteria 913
51 Ga0451843_1530960 3300041509 Bacteria 1708
52 Ga0451853_0867893 3300041512 Bacteria 3445
53 Ga0451853_0920399 3300041512 Bacteria 855
54 Ga0439455_0003344 3300042012 Bacteria 3050
55 Ga0450894_001221 3300042131 Bacteria 3783
56 Ga0450896_000797 3300042133 Bacteria 3560
57 Ga0450898_002606 3300042134 Bacteria 2526
58 Ga0450906_000197 3300042145 Bacteria 11409
59 Ga0466966_0206769 3300044684 Bacteria 1187
60 Ga0466961_0326807 3300044693 Bacteria 935
61 Ga0466963_0341589 3300044694 Bacteria 1054
62 Ga0466970_0083381 3300044765 Bacteria 1730
63 Ga0466958_0273997 3300045836 Bacteria 1081
64 Ga0466967_0200587 3300045976 Bacteria 1889
65 Ga0495603_0012208 3300046455 Bacteria 5202
66 Ga0495629_0004434 3300046459 Bacteria 10518
67 Ga0495641_0257018 3300046461 Bacteria 786
68 Ga0495641_0359593 3300046461 Bacteria 659
69 Ga0495639_0011717 3300046475 Bacteria 3782
70 Ga0495662_0172428 3300046476 Bacteria 1066
71 Ga0495594_0002274 3300046499 Bacteria 10008
72 Ga0495594_0104055 3300046499 Bacteria 1598
73 Ga0495607_0201365 3300046501 Bacteria 985
74 Ga0495620_0025476 3300046515 Bacteria 2797
75 Ga0495666_0001587 3300046526 Bacteria 11187
76 Ga0495640_0036588 3300046533 Bacteria 3468
77 Ga0495586_0063704 3300046535 Bacteria 2008
78 Ga0495622_0001218 3300046557 Bacteria 13213
79 Ga0495668_0007632 3300046616 Bacteria 6885
80 Ga0495634_0078639 3300046642 Bacteria 2160
81 Ga0495624_0002611 3300046690 Bacteria 13602
82 Ga0495589_0026136 3300046794 Bacteria 2960
83 Ga0495589_0183135 3300046794 Bacteria 993
84 Ga0495581_0013508 3300047315 Bacteria 4736
85 Ga0495636_0026343 3300047318 Bacteria 2365
86 Ga0495676_0011711 3300047321 Bacteria 7908
87 Ga0495685_008255 3300047447 Bacteria 3452
88 Ga0495684_0434098 3300047471 Bacteria 916
89 Ga0495602_0246201 3300048088 Bacteria 1335
90 Ga0495614_0016363 3300048089 Bacteria 3228
91 Ga0496115_0220090 3300048918 Bacteria 1567
92 Ga0501033_0027130 3300049570 Bacteria 4308
93 Ga0501034_0017406 3300049571 Bacteria 7372
94 Ga0501034_0287328 3300049571 Bacteria 1583
95 Ga0501036_0003007 3300049572 Bacteria 13416
96 Ga0501036_0008555 3300049572 Bacteria 8392
97 Ga0501037_0007927 3300049573 Bacteria 7781
98 Ga0501038_0001037 3300049574 Bacteria 25085
99 Ga0501038_0018586 3300049574 Bacteria 6277
100 Ga0501039_0024454 3300049575 Bacteria 4640
101 Ga0501039_0061924 3300049575 Bacteria 2898
102 Ga0501042_0003369 3300049578 Bacteria 10023
103 Ga0501043_0002134 3300049579 Bacteria 16883
104 Ga0501043_0053435 3300049579 Bacteria 3172
105 Ga0501047_0054229 3300049581 Bacteria 3877
106 Ga0501048_0002889 3300049582 Bacteria 13113
107 Ga0501070_0002822 3300049586 Bacteria 15159
108 Ga0501074_0000701 3300049590 Bacteria 20963
109 Ga0501044_0105577 3300049823 Bacteria 2829
110 Ga0501045_0055560 3300049824 Bacteria 2895
111 Ga0495612_0015086 3300053078 Bacteria 3097
112 Ga0500644_0167124 3300053088 Bacteria 892
113 Ga0500560_093687 3300053107 Bacteria 1005
114 Ga0500616_0013815 3300053153 Bacteria 4664
115 Ga0466962_0191924 3300061719 Bacteria 997
116 3006428786 3006425503 Bacteria 6491253
117 2643946369 2643221587 Bacteria 7586415
118 2644266826 2643221647 Bacteria 10741251
119 2644434173 2643221677 Bacteria 7584031
120 2644631393 2643221714 Bacteria 9015452
121 2671832979 2671180195 Bacteria 9757215
122 2676198731 2675902999 Bacteria 9438463
123 2676478461 2675903058 Bacteria 6822861
124 2676494269 2675903060 Bacteria 10051191
125 2686537219 2684623035 Bacteria 8032739
126 2689960016 2687453737 Bacteria 11203906
127 2774851135 2773857922 Bacteria 9757215
128 2793977591 2791355406 Bacteria 11364898
129 2827629519 2827628540 Bacteria 6858585
130 2831936213 2831935698 Bacteria 5963223
131 2856742324 2856741275 Bacteria 8096094
132 2862292885 2862290372 Bacteria 7471434
133 2862392110 2862382967 Bacteria 10317375
134 2863407493 2863404153 Bacteria 9672205
135 2863410865 2863404153 Bacteria 9672205
136 2867371027 2867369537 Bacteria 6501581
137 2867371248 2867369537 Bacteria 6501581
138 2867507199 2867507094 Bacteria 6506033
139 2868095801 2868088558 Bacteria 7609351
140 2870788148 2870782633 Bacteria 9624083
141 2873321939 2873314349 Bacteria 8512634
142 2891555587 2891554331 Bacteria 8812224
143 2891565399 2891562705 Bacteria 8039471
144 2895887312 2895880812 Bacteria 11255272
145 2899370376 2899370129 Bacteria 6781179
146 2918502704 2918501144 Bacteria 8668083
147 2954009878 2954002825 Bacteria 9173742
148 2954692063 2954691527 Bacteria 10720516
149 2954707130 2954701450 Bacteria 10834262
150 2997456492 2997451912 Bacteria 8492419
151 2997600331 2997600082 Bacteria 9896405
152 8008564992 8008558824 Bacteria 10610750
153 8047898022 8047893842 Bacteria 11723082
154 8048137321 8048127548 Bacteria 11053136
155 8048360871 8048356638 Bacteria 11044339
156 8048374985 8048369669 Bacteria 11666822
157 8048383221 8048379754 Bacteria 11877923
158 8055174946 8055172936 Bacteria 9305943
159 8057568800 8057568493 Bacteria 7221719
160 JGI24739J22299_10054223
161 JGI24735J21928_10034598
162 JGI24738J21930_10012470
163 JGI25406J46586_10001445
164 rootH2_10063368
165 rootL2_10053404
166 JGI25160J50197_1026865
167 Ga0065714_10069351
168 Ga0070658_10273485
169 Ga0070668_100140599
170 Ga0070714_100000006
171 Ga0070710_10390964
172 Ga0070698_100168293
173 Ga0070699_100776891
174 Ga0070693_100684603
175 Ga0070664_100373307
176 Ga0068856_100297249
177 Ga0081455_10000123
178 Ga0081539_10000254
179 Ga0099826_10142915
180 Ga0105238_10293829
181 Ga0105246_10198879
182 Ga0105246_11024104
183 Ga0157369_10467210
184 Ga0157372_10350490
185 Ga0182007_10002230
186 Ga0207426_1004446
187 Ga0207426_1009157
188 Ga0207692_10331326
189 Ga0207647_10022335
190 Ga0207707_10590835
191 Ga0207694_10110974
192 Ga0207694_10280070
193 Ga0207664_10000032
194 Ga0207679_10511816
195 Ga0207668_10015594
196 Ga0207668_10281436
197 Ga0207702_10436904
198 Ga0307517_10182207
199 Ga0307515_10246911
200 Ga0307513_10004144
201 Ga0307508_10003098
202 Ga0307518_10294060
203 Ga0395898_0002672
204 Ga0395905_0748328
205 Ga0436364_0281980
206 Ga0395901_0030134
207 Ga0395901_0059991
208 Ga0439436_0010993
209 Ga0451839_1479651
210 Ga0451843_1530960
211 Ga0451853_0867893
212 Ga0451853_0920399
213 Ga0439455_0003344
214 Ga0450894_001221
215 Ga0450896_000797
216 Ga0450898_002606
217 Ga0450906_000197
218 Ga0466966_0206769
219 Ga0466961_0326807
220 Ga0466963_0341589
221 Ga0466970_0083381
222 Ga0466958_0273997
223 Ga0466967_0200587
224 Ga0495603_0012208
225 Ga0495629_0004434
226 Ga0495641_0257018
227 Ga0495641_0359593
228 Ga0495639_0011717
229 Ga0495662_0172428
230 Ga0495594_0002274
231 Ga0495594_0104055
232 Ga0495607_0201365
233 Ga0495620_0025476
234 Ga0495666_0001587
235 Ga0495640_0036588
236 Ga0495586_0063704
237 Ga0495622_0001218
238 Ga0495668_0007632
239 Ga0495634_0078639
240 Ga0495624_0002611
241 Ga0495589_0026136
242 Ga0495589_0183135
243 Ga0495581_0013508
244 Ga0495636_0026343
245 Ga0495676_0011711
246 Ga0495685_008255
247 Ga0495684_0434098
248 Ga0495602_0246201
249 Ga0495614_0016363
250 Ga0496115_0220090
251 Ga0501033_0027130
252 Ga0501034_0017406
253 Ga0501034_0287328
254 Ga0501036_0003007
255 Ga0501036_0008555
256 Ga0501037_0007927
257 Ga0501038_0001037
258 Ga0501038_0018586
259 Ga0501039_0024454
260 Ga0501039_0061924
261 Ga0501042_0003369
262 Ga0501043_0002134
263 Ga0501043_0053435
264 Ga0501047_0054229
265 Ga0501048_0002889
266 Ga0501070_0002822
267 Ga0501074_0000701
268 Ga0501044_0105577
269 Ga0501045_0055560
270 Ga0495612_0015086
271 Ga0500644_0167124
272 Ga0500560_093687
273 Ga0500616_0013815
274 Ga0466962_0191924
275 3006428786
276 2643946369
277 2644266826
278 2644434173
279 2644631393
280 2671832979
281 2676198731
282 2676478461
283 2676494269
284 2686537219
285 2689960016
286 2774851135
287 2793977591
288 2827629519
289 2831936213
290 2856742324
291 2862292885
292 2862392110
293 2863407493
294 2863410865
295 2867371027
296 2867371248
297 2867507199
298 2868095801
299 2870788148
300 2873321939
301 2891555587
302 2891565399
303 2895887312
304 2899370376
305 2918502704
306 2954009878
307 2954692063
308 2954707130
309 2997456492
310 2997600331
311 8008564992
312 8047898022
313 8048137321
314 8048360871
315 8048374985
316 8048383221
317 8055174946
318 8057568800

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

36

204

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xf4-assembly1.cif.gz_A-2 crystal structure of salmonella enterica serovar typhimurium ycbl 0.9256 25 202
2zzi-assembly1.cif.gz_A crystal structure of ttha1623 in a di-iron-bound form 0.8882 25 199
7l0b-assembly4.cif.gz_D crystal structure of hydroxyacyl glutathione hydrolase (glob) from staphylococcus aureus, apoenzyme 0.8544 7 199
4ysb-assembly1.cif.gz_B crystal structure of ethe1 from myxococcus xanthus 0.8359 25 202
7ev5-assembly1.cif.gz_A crystal structure of bleg-1 b3 metallo-beta-lactamase 0.8333 10 202
ID Description Score Start End Superfamily
af_O53534_19_208_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9788 21 206 3.60.15.10
af_O53534_19_208_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9533 21 206 3.60.15.10
2xf4A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9256 25 202 3.60.15.10
af_I6Y4A5_15_234_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8721 25 207 3.60.15.10
af_Q682P6_229_394_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8348 37 193 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A7K3GFG1-F1-model_v4 MBL fold metallo-hydrolase 1.001 1 98 GO:0016787
AF-A0A6B3FJ40-F1-model_v4 MBL fold metallo-hydrolase 1.001 23 96 GO:0016787
AF-A0A7V9BVA7-F1-model_v4 MBL fold metallo-hydrolase 0.9969 5 76 GO:0016787
AF-A0A0L8L857-F1-model_v4 Zn-dependent hydrolase 0.991 1 210 GO:0016787
AF-A0A117QXC1-F1-model_v4 Zn-dependent hydrolase 0.9902 1 210 GO:0016787

Map