F232922

General Info

Members Datasets Scaffolds Average Seq Length
159 124 157 117

Family's Representative Sequence

Representative Sequence 3300046506|Ga0495583_0083950|Ga0495583_0083950_472_888
Length 138
Sequence MLRRACVGAEGCRTRLLLSRSMEKPTAISALSALAHEGRLDIFRLLVRAGAEGMAAGEIARTTGAAASTQSVNLAILSRAGLVAARRDGRSIIYAAAYDQMRDLLGFLMEDCCAGRPEICAPLAALASQPCAAEGRTC

Samples

Sample ID Description Type Environment
1 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
2 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
26 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
36 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
37 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
38 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
39 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
60 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
61 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
62 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
63 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
64 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
65 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
66 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
67 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
68 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
69 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
70 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
71 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
72 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
73 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
74 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
75 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
76 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
77 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
78 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
79 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
80 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
81 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
82 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
83 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
84 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
85 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
86 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
87 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
88 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
89 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
90 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
91 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
92 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
93 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
94 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
95 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
96 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
97 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
98 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
99 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
100 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
101 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
102 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
103 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
104 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
105 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
106 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
107 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
108 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
109 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
110 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
111 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
112 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
114 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
115 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
116 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
117 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
118 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
119 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
120 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
121 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
122 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
123 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
124 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.74
Metatranscriptomes 0
Isolates 1.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.09
Nodule 0
Rhizoplane 1.26
Rhizosphere 81.13
Stem 0
Stem Tuber 0
Unclassified 2.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10000192 3300002067 Bacteria 21729
2 JGI25153J46596_10037128 3300003215 Bacteria 1553
3 Ga0055530_10000447 3300003791 Bacteria 36678
4 Ga0055531_10019132 3300003794 Bacteria 2788
5 Ga0055531_10031013 3300003794 Bacteria 1780
6 Ga0065165_1000245 3300005262 Bacteria 93370
7 Ga0065165_1010816 3300005262 Bacteria 3890
8 Ga0070658_11195146 3300005327 Bacteria 661
9 Ga0070660_100040659 3300005339 Bacteria 3540
10 Ga0070661_101127460 3300005344 Bacteria 654
11 Ga0070673_102226554 3300005364 Bacteria 521
12 Ga0070659_100543162 3300005366 Bacteria 994
13 Ga0070711_100283568 3300005439 Bacteria 1311
14 Ga0070663_100119229 3300005455 Bacteria 1991
15 Ga0070662_100008544 3300005457 Bacteria 6678
16 Ga0068853_100045519 3300005539 Bacteria 3758
17 Ga0070686_100556456 3300005544 Bacteria 898
18 Ga0070693_100145489 3300005547 Bacteria 1496
19 Ga0070665_100000136 3300005548 Bacteria 138094
20 Ga0070665_100192161 3300005548 Bacteria 2042
21 Ga0070665_100352578 3300005548 Bacteria 1477
22 Ga0070665_101882340 3300005548 Bacteria 604
23 Ga0070664_100260896 3300005564 Bacteria 1559
24 Ga0070664_100483886 3300005564 Bacteria 1139
25 Ga0070664_100860390 3300005564 Bacteria 849
26 Ga0068859_102889642 3300005617 Bacteria 526
27 Ga0068863_101095470 3300005841 Bacteria 801
28 Ga0068858_100072895 3300005842 Bacteria 3187
29 Ga0068858_100706635 3300005842 Bacteria 981
30 Ga0070717_10146165 3300006028 Bacteria 2042
31 Ga0075370_10018407 3300006353 Bacteria 3790
32 Ga0068865_100000217 3300006881 Bacteria 32094
33 Ga0097620_102889608 3300006931 Bacteria 526
34 Ga0105240_10042856 3300009093 Bacteria 5765
35 Ga0105245_10524784 3300009098 Bacteria 1203
36 Ga0105241_10004379 3300009174 Bacteria 10437
37 Ga0105238_10038387 3300009551 Bacteria 4864
38 Ga0105238_10077547 3300009551 Bacteria 3314
39 Ga0105239_13322322 3300010375 Bacteria 523
40 Ga0163162_12292357 3300013306 Bacteria 620
41 Ga0157372_10019142 3300013307 Bacteria 7371
42 Ga0157377_10939646 3300014745 Bacteria 650
43 Ga0157379_10000434 3300014968 Bacteria 33885
44 Ga0209026_1014142 3300025250 Bacteria 1341
45 Ga0209758_1001063 3300025297 Bacteria 35771
46 Ga0209050_1000049 3300025298 Bacteria 364096
47 Ga0209257_1000327 3300025304 Bacteria 99581
48 Ga0209257_1007869 3300025304 Bacteria 6279
49 Ga0207647_10000604 3300025904 Bacteria 27991
50 Ga0207705_10089036 3300025909 Bacteria 2258
51 Ga0207705_10841469 3300025909 Bacteria 712
52 Ga0207654_10017573 3300025911 Bacteria 3742
53 Ga0207695_10002462 3300025913 Bacteria 27332
54 Ga0207663_10240906 3300025916 Bacteria 1327
55 Ga0207657_10010882 3300025919 Bacteria 9053
56 Ga0207694_10092754 3300025924 Bacteria 2384
57 Ga0207694_10202515 3300025924 Bacteria 1615
58 Ga0207687_10618307 3300025927 Bacteria 914
59 Ga0207706_10001626 3300025933 Bacteria 22272
60 Ga0207704_10315278 3300025938 Bacteria 1204
61 Ga0207679_10265148 3300025945 Bacteria 1467
62 Ga0207679_10400741 3300025945 Bacteria 1207
63 Ga0207679_11183834 3300025945 Bacteria 701
64 Ga0207703_10056201 3300026035 Bacteria 3204
65 Ga0207703_10359880 3300026035 Bacteria 1342
66 Ga0207678_10060047 3300026067 Bacteria 3271
67 Ga0207678_10496845 3300026067 Bacteria 1063
68 Ga0207702_11142940 3300026078 Bacteria 773
69 Ga0207648_10785450 3300026089 Bacteria 886
70 Ga0207676_11347466 3300026095 Bacteria 709
71 Ga0207683_11563737 3300026121 Bacteria 608
72 Ga0268266_10000003 3300028379 Bacteria 1701703
73 Ga0268266_10409459 3300028379 Bacteria 1283
74 Ga0265338_10002925 3300028800 Bacteria 24783
75 Ga0265325_10000032 3300031241 Bacteria 102199
76 Ga0265325_10036919 3300031241 Bacteria 2586
77 Ga0265339_10039789 3300031249 Bacteria 2616
78 Ga0265339_10071313 3300031249 Bacteria 1851
79 Ga0265331_10144129 3300031250 Bacteria 1082
80 Ga0307513_10022605 3300031456 Bacteria 7384
81 Ga0265313_10038916 3300031595 Bacteria 2364
82 Ga0265313_10057891 3300031595 Bacteria 1828
83 Ga0307413_11953197 3300031824 Bacteria 528
84 Ga0307410_10958895 3300031852 Bacteria 736
85 Ga0307411_11788858 3300032005 Bacteria 570
86 Ga0307510_10080733 3300033180 Bacteria 3160
87 Ga0373935_0246366 3300035692 Bacteria 1249
88 Ga0373927_0177005 3300035695 Bacteria 1399
89 Ga0373927_0338928 3300035695 Bacteria 990
90 Ga0373933_0113341 3300035724 Bacteria 1693
91 Ga0373937_0001085 3300036401 Bacteria 22954
92 Ga0373937_0304853 3300036401 Bacteria 1506
93 Ga0373925_0406513 3300037068 Bacteria 1111
94 Ga0395899_0000091 3300037312 Bacteria 154780
95 Ga0395899_0528921 3300037312 Bacteria 761
96 Ga0395900_0000008 3300037418 Bacteria 480459
97 Ga0395898_0157574 3300037466 Bacteria 2171
98 Ga0395905_0024759 3300037471 Bacteria 5664
99 Ga0395905_0472295 3300037471 Bacteria 1153
100 Ga0395901_0000008 3300038443 Bacteria 495962
101 Ga0439448_0002952 3300042005 Bacteria 4667
102 Ga0439455_0000219 3300042012 Bacteria 6802
103 Ga0466969_0272979 3300044656 Bacteria 766
104 Ga0466965_0045309 3300044683 Bacteria 2175
105 Ga0466966_0086631 3300044684 Bacteria 1947
106 Ga0466961_0010111 3300044693 Bacteria 6011
107 Ga0466964_0127994 3300044706 Unclassified 1153
108 Ga0466971_0048948 3300044719 Bacteria 1901
109 Ga0466970_0024251 3300044765 Bacteria 3171
110 Ga0466959_0004236 3300045049 Bacteria 9569
111 Ga0466959_0775896 3300045049 Bacteria 641
112 Ga0466958_0088920 3300045836 Bacteria 1909
113 Ga0495650_0026487 3300046471 Bacteria 2696
114 Ga0495594_0760257 3300046499 Bacteria 547
115 Ga0495583_0083950 3300046506 Bacteria 1381
116 Ga0495610_0031094 3300046512 Bacteria 2789
117 Ga0495643_0477793 3300046522 Bacteria 539
118 Ga0495644_0352873 3300046523 Bacteria 579
119 Ga0495642_0027986 3300046528 Bacteria 2243
120 Ga0495665_0530748 3300046531 Bacteria 591
121 Ga0495668_0021932 3300046616 Bacteria 3655
122 Ga0495668_0044094 3300046616 Bacteria 2479
123 Ga0495668_0065124 3300046616 Bacteria 2006
124 Ga0495668_0077847 3300046616 Bacteria 1821
125 Ga0495668_0086119 3300046616 Bacteria 1723
126 Ga0495668_0087364 3300046616 Bacteria 1710
127 Ga0495668_0246940 3300046616 Bacteria 977
128 Ga0495611_0022408 3300046648 Bacteria 2733
129 Ga0495625_0032453 3300046660 Bacteria 3870
130 Ga0495588_0207438 3300046674 Bacteria 1035
131 Ga0495669_0098381 3300046684 Bacteria 1357
132 Ga0495613_0208276 3300046689 Bacteria 1376
133 Ga0495649_0089241 3300046694 Bacteria 1644
134 Ga0495636_0130235 3300047318 Bacteria 1119
135 Ga0495683_0300721 3300047323 Bacteria 689
136 Ga0495677_0063369 3300047445 Bacteria 1373
137 Ga0495681_0083016 3300047470 Bacteria 1427
138 Ga0495686_0003728 3300047472 Bacteria 13003
139 Ga0495593_0149647 3300047673 Bacteria 1181
140 Ga0496106_0473951 3300048909 Bacteria 1006
141 Ga0496106_1274611 3300048909 Bacteria 571
142 Ga0501047_1076224 3300049581 Bacteria 617
143 Ga0501241_012656 3300049758 Bacteria 1534
144 nmdc:mga03683_183560_c1 3300050489 Bacteria 955
145 nmdc:mga03683_207064_c1 3300050489 Bacteria 901
146 nmdc:mga0yw44_124161_c1 3300050492 Bacteria 1665
147 nmdc:mga0sz30_331927_c1 3300050516 Bacteria 679
148 Ga0500643_071726 3300053087 Bacteria 960
149 Ga0500641_0002324 3300053096 Bacteria 6739
150 Ga0500556_0006763 3300053104 Bacteria 3260
151 Ga0500562_029418 3300053108 Bacteria 1445
152 Ga0500562_063022 3300053108 Bacteria 997
153 Ga0500616_0038188 3300053153 Bacteria 2595
154 Ga0500622_0003059 3300053156 Bacteria 11547
155 Ga0500645_002258 3300053730 Bacteria 8756
156 Ga0500645_039501 3300053730 Bacteria 1397
157 Ga0466962_0559756 3300061719 Bacteria 581

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2928972540 2928973347 108
2 3300005539 Ga0068853_100045519 Ga0068853_1000455194 109
3 iso_pu_bacteria 2899803654 2899807702 109
4 3300053087 Ga0500643_071726 Ga0500643_071726_177_512 110
5 3300053104 Ga0500556_0006763 Ga0500556_0006763_1240_1575 110
6 3300053108 Ga0500562_029418 Ga0500562_029418_516_851 110
7 3300053153 Ga0500616_0038188 Ga0500616_0038188_1960_2295 110
8 3300053730 Ga0500645_039501 Ga0500645_039501_943_1278 110
9 3300003215 JGI25153J46596_10037128 JGI25153J46596_100371282 111
10 3300003791 Ga0055530_10000447 Ga0055530_1000044717 111
11 3300003794 Ga0055531_10019132 Ga0055531_100191324 111
12 3300003794 Ga0055531_10031013 Ga0055531_100310133 111
13 3300005262 Ga0065165_1000245 Ga0065165_100024577 111
14 3300005262 Ga0065165_1010816 Ga0065165_10108164 111
15 3300005327 Ga0070658_11195146 Ga0070658_111951462 111
16 3300005339 Ga0070660_100040659 Ga0070660_1000406594 111
17 3300005364 Ga0070673_102226554 Ga0070673_1022265542 111
18 3300005544 Ga0070686_100556456 Ga0070686_1005564562 111
19 3300005548 Ga0070665_100000136 Ga0070665_10000013625 111
20 3300005548 Ga0070665_100192161 Ga0070665_1001921614 111
21 3300005548 Ga0070665_100352578 Ga0070665_1003525783 111
22 3300005548 Ga0070665_101882340 Ga0070665_1018823402 111
23 3300005564 Ga0070664_100260896 Ga0070664_1002608962 111
24 3300005564 Ga0070664_100860390 Ga0070664_1008603902 111
25 3300005617 Ga0068859_102889642 Ga0068859_1028896421 111
26 3300005841 Ga0068863_101095470 Ga0068863_1010954702 111
27 3300006028 Ga0070717_10146165 Ga0070717_101461653 111
28 3300006353 Ga0075370_10018407 Ga0075370_100184076 111
29 3300006881 Ga0068865_100000217 Ga0068865_10000021725 111
30 3300006931 Ga0097620_102889608 Ga0097620_1028896081 111
31 3300009093 Ga0105240_10042856 Ga0105240_100428565 111
32 3300009098 Ga0105245_10524784 Ga0105245_105247843 111
33 3300009551 Ga0105238_10038387 Ga0105238_100383874 111
34 3300009551 Ga0105238_10077547 Ga0105238_100775473 111
35 3300010375 Ga0105239_13322322 Ga0105239_133223222 111
36 3300013306 Ga0163162_12292357 Ga0163162_122923572 111
37 3300025250 Ga0209026_1014142 Ga0209026_10141422 111
38 3300025297 Ga0209758_1001063 Ga0209758_100106317 111
39 3300025298 Ga0209050_1000049 Ga0209050_1000049316 111
40 3300025304 Ga0209257_1000327 Ga0209257_100032721 111
41 3300025304 Ga0209257_1007869 Ga0209257_10078695 111
42 3300025909 Ga0207705_10089036 Ga0207705_100890364 111
43 3300025909 Ga0207705_10841469 Ga0207705_108414692 111
44 3300025913 Ga0207695_10002462 Ga0207695_1000246229 111
45 3300025919 Ga0207657_10010882 Ga0207657_100108826 111
46 3300025924 Ga0207694_10092754 Ga0207694_100927544 111
47 3300025924 Ga0207694_10202515 Ga0207694_102025153 111
48 3300025927 Ga0207687_10618307 Ga0207687_106183071 111
49 3300025938 Ga0207704_10315278 Ga0207704_103152781 111
50 3300025945 Ga0207679_10265148 Ga0207679_102651482 111
51 3300025945 Ga0207679_11183834 Ga0207679_111838342 111
52 3300026067 Ga0207678_10496845 Ga0207678_104968452 111
53 3300026089 Ga0207648_10785450 Ga0207648_107854502 111
54 3300026095 Ga0207676_11347466 Ga0207676_113474662 111
55 3300026121 Ga0207683_11563737 Ga0207683_115637372 111
56 3300028379 Ga0268266_10000003 Ga0268266_10000003629 111
57 3300028379 Ga0268266_10409459 Ga0268266_104094592 111
58 3300028800 Ga0265338_10002925 Ga0265338_1000292518 111
59 3300031241 Ga0265325_10000032 Ga0265325_10000032109 111
60 3300031249 Ga0265339_10039789 Ga0265339_100397892 111
61 3300031250 Ga0265331_10144129 Ga0265331_101441292 111
62 3300031456 Ga0307513_10022605 Ga0307513_100226056 111
63 3300031595 Ga0265313_10038916 Ga0265313_100389164 111
64 3300031824 Ga0307413_11953197 Ga0307413_119531971 111
65 3300031852 Ga0307410_10958895 Ga0307410_109588952 111
66 3300032005 Ga0307411_11788858 Ga0307411_117888582 111
67 3300033180 Ga0307510_10080733 Ga0307510_100807335 111
68 3300035692 Ga0373935_0246366 Ga0373935_0246366_19_384 111
69 3300036401 Ga0373937_0304853 Ga0373937_0304853_581_928 111
70 3300037312 Ga0395899_0000091 Ga0395899_0000091_68619_68972 111
71 3300037312 Ga0395899_0528921 Ga0395899_0528921_306_659 111
72 3300037418 Ga0395900_0000008 Ga0395900_0000008_394298_394651 111
73 3300037466 Ga0395898_0157574 Ga0395898_0157574_927_1280 111
74 3300037471 Ga0395905_0024759 Ga0395905_0024759_4385_4738 111
75 3300037471 Ga0395905_0472295 Ga0395905_0472295_748_1101 111
76 3300038443 Ga0395901_0000008 Ga0395901_0000008_85809_86162 111
77 3300045049 Ga0466959_0775896 Ga0466959_0775896_26_379 111
78 3300046471 Ga0495650_0026487 Ga0495650_0026487_2207_2560 111
79 3300046499 Ga0495594_0760257 Ga0495594_0760257_115_468 111
80 3300046506 Ga0495583_0083950 Ga0495583_0083950_472_888 111
81 3300046512 Ga0495610_0031094 Ga0495610_0031094_1554_1907 111
82 3300046522 Ga0495643_0477793 Ga0495643_0477793_105_458 111
83 3300046523 Ga0495644_0352873 Ga0495644_0352873_100_453 111
84 3300046528 Ga0495642_0027986 Ga0495642_0027986_45_398 111
85 3300046531 Ga0495665_0530748 Ga0495665_0530748_22_375 111
86 3300046616 Ga0495668_0021932 Ga0495668_0021932_734_1087 111
87 3300046616 Ga0495668_0044094 Ga0495668_0044094_450_803 111
88 3300046616 Ga0495668_0065124 Ga0495668_0065124_547_900 111
89 3300046616 Ga0495668_0077847 Ga0495668_0077847_241_594 111
90 3300046616 Ga0495668_0087364 Ga0495668_0087364_385_738 111
91 3300046648 Ga0495611_0022408 Ga0495611_0022408_1634_1987 111
92 3300046660 Ga0495625_0032453 Ga0495625_0032453_3341_3754 111
93 3300046674 Ga0495588_0207438 Ga0495588_0207438_410_763 111
94 3300046684 Ga0495669_0098381 Ga0495669_0098381_379_732 111
95 3300046689 Ga0495613_0208276 Ga0495613_0208276_774_1127 111
96 3300046694 Ga0495649_0089241 Ga0495649_0089241_1012_1365 111
97 3300047318 Ga0495636_0130235 Ga0495636_0130235_182_535 111
98 3300047445 Ga0495677_0063369 Ga0495677_0063369_139_492 111
99 3300047470 Ga0495681_0083016 Ga0495681_0083016_927_1280 111
100 3300047472 Ga0495686_0003728 Ga0495686_0003728_6871_7224 111
101 3300047673 Ga0495593_0149647 Ga0495593_0149647_439_825 111
102 3300048909 Ga0496106_1274611 Ga0496106_1274611_176_529 111
103 3300050489 nmdc:mga03683_183560_c1 nmdc:mga03683_183560_c1_575_928 111
104 3300050492 nmdc:mga0yw44_124161_c1 nmdc:mga0yw44_124161_c1_191_547 111
105 3300050516 nmdc:mga0sz30_331927_c1 nmdc:mga0sz30_331927_c1_214_570 111
106 3300053730 Ga0500645_002258 Ga0500645_002258_1786_2139 111
107 3300002067 JGI24735J21928_10000192 JGI24735J21928_1000019210 112
108 3300005344 Ga0070661_101127460 Ga0070661_1011274601 112
109 3300005366 Ga0070659_100543162 Ga0070659_1005431622 112
110 3300005439 Ga0070711_100283568 Ga0070711_1002835681 112
111 3300005455 Ga0070663_100119229 Ga0070663_1001192293 112
112 3300005457 Ga0070662_100008544 Ga0070662_1000085446 112
113 3300005547 Ga0070693_100145489 Ga0070693_1001454892 112
114 3300005564 Ga0070664_100483886 Ga0070664_1004838862 112
115 3300005842 Ga0068858_100072895 Ga0068858_1000728952 112
116 3300005842 Ga0068858_100706635 Ga0068858_1007066352 112
117 3300009174 Ga0105241_10004379 Ga0105241_100043796 112
118 3300013307 Ga0157372_10019142 Ga0157372_100191429 112
119 3300014745 Ga0157377_10939646 Ga0157377_109396461 112
120 3300014968 Ga0157379_10000434 Ga0157379_1000043412 112
121 3300025904 Ga0207647_10000604 Ga0207647_1000060410 112
122 3300025911 Ga0207654_10017573 Ga0207654_100175736 112
123 3300025916 Ga0207663_10240906 Ga0207663_102409061 112
124 3300025933 Ga0207706_10001626 Ga0207706_100016268 112
125 3300025945 Ga0207679_10400741 Ga0207679_104007412 112
126 3300026035 Ga0207703_10056201 Ga0207703_100562016 112
127 3300026035 Ga0207703_10359880 Ga0207703_103598802 112
128 3300026067 Ga0207678_10060047 Ga0207678_100600475 112
129 3300026078 Ga0207702_11142940 Ga0207702_111429402 112
130 3300031241 Ga0265325_10036919 Ga0265325_100369193 112
131 3300031249 Ga0265339_10071313 Ga0265339_100713132 112
132 3300031595 Ga0265313_10057891 Ga0265313_100578912 112
133 3300035695 Ga0373927_0177005 Ga0373927_0177005_461_814 112
134 3300035695 Ga0373927_0338928 Ga0373927_0338928_491_844 112
135 3300035724 Ga0373933_0113341 Ga0373933_0113341_108_464 112
136 3300036401 Ga0373937_0001085 Ga0373937_0001085_12299_12655 112
137 3300037068 Ga0373925_0406513 Ga0373925_0406513_506_862 112
138 3300042005 Ga0439448_0002952 Ga0439448_0002952_630_971 112
139 3300042012 Ga0439455_0000219 Ga0439455_0000219_4859_5200 112
140 3300044656 Ga0466969_0272979 Ga0466969_0272979_276_617 112
141 3300044683 Ga0466965_0045309 Ga0466965_0045309_1590_1931 112
142 3300044684 Ga0466966_0086631 Ga0466966_0086631_915_1256 112
143 3300044693 Ga0466961_0010111 Ga0466961_0010111_3670_4011 112
144 3300044706 Ga0466964_0127994 Ga0466964_0127994_609_950 112
145 3300044719 Ga0466971_0048948 Ga0466971_0048948_1470_1811 112
146 3300044765 Ga0466970_0024251 Ga0466970_0024251_1851_2192 112
147 3300045049 Ga0466959_0004236 Ga0466959_0004236_2790_3131 112
148 3300045836 Ga0466958_0088920 Ga0466958_0088920_1338_1679 112
149 3300046616 Ga0495668_0086119 Ga0495668_0086119_716_1081 112
150 3300046616 Ga0495668_0246940 Ga0495668_0246940_479_838 112
151 3300047323 Ga0495683_0300721 Ga0495683_0300721_154_504 112
152 3300048909 Ga0496106_0473951 Ga0496106_0473951_613_966 112
153 3300049581 Ga0501047_1076224 Ga0501047_1076224_112_483 112
154 3300049758 Ga0501241_012656 Ga0501241_012656_1013_1369 112
155 3300050489 nmdc:mga03683_207064_c1 nmdc:mga03683_207064_c1_498_869 112
156 3300053096 Ga0500641_0002324 Ga0500641_0002324_4190_4573 112
157 3300053108 Ga0500562_063022 Ga0500562_063022_401_766 112
158 3300053156 Ga0500622_0003059 Ga0500622_0003059_8051_8416 112
159 3300061719 Ga0466962_0559756 Ga0466962_0559756_203_544 112

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

34

86

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cll-assembly1.cif.gz_F structural insights into human tfiiic promoter recognition 0.9471 15 75
6j05-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9459 1 87
8iuh-assembly1.cif.gz_P rna polymerase iii pre-initiation complex open complex 1 0.9395 18 75
2dk5-assembly1.cif.gz_A solution structure of winged-helix domain in rna polymerase iii 39kda polypeptide 0.9303 15 75
6j05-assembly1.cif.gz_A structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9241 1 95
ID Description Score Start End Superfamily
af_P32910_88_152_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9792 17 75 1.10.10.10
af_Q9VD25_77_142_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9761 15 75 1.10.10.10
af_O94553_84_149_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9761 15 75 1.10.10.10
af_Q69XJ1_51_114_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9652 18 74 1.10.10.10
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9617 13 78 1.10.10.10
ID Description Score Start End GO Terms
AF-I9WSF8-F1-model_v4 deleted 0.9976 1 89
AF-A0A084U5I5-F1-model_v4 Regulatory protein ArsR 0.9953 1 91 GO:0003700
AF-A0A530K0I7-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9946 1 85 GO:0003700
AF-A0A1F3YRF7-F1-model_v4 Transcriptional regulator 0.9937 1 87 GO:0003700
AF-A0A212JDE4-F1-model_v4 Transcriptional regulator, ArsR family, putative (Modular protein) 0.9933 2 89 GO:0003700

Feature Viewer

pLDDT pTM Quality
91.47 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map