F232508

General Info

Members Datasets Scaffolds Average Seq Length
159 101 160 216

Family's Representative Sequence

Representative Sequence 3300031595|Ga0265313_10011013|Ga0265313_100110134
Length 245
Sequence MTHTVHPYAHRLGIIRDWKSRWFAGDKKNYRENIRVDEAIRSFLTKKLRGTYTSRIEIERTANELKVIVHTARPGLVIGRSGENAAKLRKELTDLVRSAASAHGRKLALDIIEIRQPETDAAVVAWMVAEGLEKRLPFRRVLKSTVEKVIAVREVVGVRITISGRLGGADMSRKEEIKKGRIPLQTFRADIDFANEKANLPYGVIGIKVWIYRGEVLGGAEHGSRPEATRVAPQATVPSAPGQRG

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
31 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
32 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
33 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
34 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
49 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
50 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
51 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
52 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
53 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
54 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
55 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
56 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
57 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
58 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
59 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
60 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
61 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
62 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
63 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
64 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
65 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
66 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
67 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
68 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
69 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
70 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
71 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
72 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
73 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
74 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
75 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
76 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
77 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
78 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
88 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
89 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
90 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
91 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
92 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
93 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
94 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
96 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
97 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
98 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.48
Metatranscriptomes 2.52
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.89
Nodule 0
Rhizoplane 0.63
Rhizosphere 94.34
Stem 0
Stem Tuber 0
Unclassified 3.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_FSXC77061_b1 2010549000 Bacteria 798
2 JGI24743J22301_10031918 3300001991 Bacteria 1039
3 JGI24033J26618_1000142 3300002155 Bacteria 9538
4 rootH2_10050166 3300003320 Bacteria 16007
5 rootH2_10279320 3300003320 Bacteria 1483
6 rootL2_10048990 3300003322 Bacteria 2102
7 rootH1_10015537 3300003323 Bacteria 8046
8 rootH1_10173523 3300003316 Bacteria 1299
9 rootH1_10173523 3300003323 Bacteria 9945
10 Ga0070680_100049374 3300005336 Unclassified 3430
11 Ga0070680_100089313 3300005336 Bacteria 2550
12 Ga0070661_100001994 3300005344 Bacteria 14112
13 Ga0070675_100185313 3300005354 Bacteria 1801
14 Ga0070671_100294500 3300005355 Bacteria 1381
15 Ga0070674_100135982 3300005356 Bacteria 1838
16 Ga0070673_100624630 3300005364 Bacteria 984
17 Ga0070659_100100884 3300005366 Bacteria 2323
18 Ga0070711_100019344 3300005439 Unclassified 4368
19 Ga0070681_10221940 3300005458 Bacteria 1805
20 Ga0070681_10510811 3300005458 Bacteria 1115
21 Ga0070679_100276871 3300005530 Bacteria 1631
22 Ga0070686_100013900 3300005544 Bacteria 4623
23 Ga0070695_100562320 3300005545 Bacteria 890
24 Ga0068855_100519230 3300005563 Bacteria 1292
25 Ga0068856_100004352 3300005614 Bacteria 14113
26 Ga0068866_10000010 3300005718 Bacteria 98038
27 Ga0068861_100348454 3300005719 Bacteria 1298
28 Ga0068858_100073288 3300005842 Unclassified 3179
29 Ga0068871_100910698 3300006358 Bacteria 815
30 Ga0105240_10002329 3300009093 Bacteria 30732
31 Ga0105242_10000033 3300009176 Bacteria 98044
32 Ga0105238_10000248 3300009551 Bacteria 60289
33 Ga0105249_10015433 3300009553 Bacteria 6761
34 Ga0105239_10000158 3300010375 Bacteria 98044
35 Ga0157374_10052238 3300013296 Bacteria 3805
36 Ga0157378_10001234 3300013297 Bacteria 23136
37 Ga0157378_10185207 3300013297 Bacteria 1961
38 Ga0157375_10047456 3300013308 Bacteria 4194
39 Ga0157379_10041594 3300014968 Bacteria 4103
40 Ga0207642_10000011 3300025899 Bacteria 87813
41 Ga0207695_10001546 3300025913 Bacteria 37859
42 Ga0207663_10030267 3300025916 Unclassified 3191
43 Ga0207660_10150313 3300025917 Unclassified 1789
44 Ga0207649_10000215 3300025920 Bacteria 47922
45 Ga0207652_10031978 3300025921 Unclassified 4420
46 Ga0207652_10116856 3300025921 Unclassified 2370
47 Ga0207694_10029616 3300025924 Unclassified 4178
48 Ga0207659_10228373 3300025926 Bacteria 1500
49 Ga0207686_10000040 3300025934 Bacteria 125321
50 Ga0207667_10067298 3300025949 Unclassified 3732
51 Ga0207712_10010036 3300025961 Bacteria 6001
52 Ga0207703_10115588 3300026035 Bacteria 2296
53 Ga0207703_10889565 3300026035 Unclassified 852
54 Ga0207702_10003580 3300026078 Bacteria 14118
55 Ga0207675_100394112 3300026118 Bacteria 1363
56 Ga0265337_1003046 3300028556 Bacteria 7403
57 Ga0265337_1075289 3300028556 Unclassified 925
58 Ga0265334_10025434 3300028573 Bacteria 2396
59 Ga0265334_10060017 3300028573 Bacteria 1436
60 Ga0265318_10005814 3300028577 Bacteria 5751
61 Ga0265318_10017898 3300028577 Unclassified 2901
62 Ga0265318_10030189 3300028577 Unclassified 2109
63 Ga0265318_10043543 3300028577 Unclassified 1701
64 Ga0265336_10000018 3300028666 Bacteria 221454
65 Ga0265338_10000002 3300028800 Bacteria 856588
66 Ga0265338_10000049 3300028800 Bacteria 217212
67 Ga0265338_10000380 3300028800 Bacteria 79593
68 Ga0265338_10001848 3300028800 Bacteria 33242
69 Ga0265338_10002122 3300028800 Bacteria 30467
70 Ga0265338_10044087 3300028800 Bacteria 4124
71 Ga0265338_10047320 3300028800 Bacteria 3929
72 Ga0265338_10052804 3300028800 Bacteria 3643
73 Ga0265338_10066402 3300028800 Bacteria 3122
74 Ga0265338_10124521 3300028800 Bacteria 2048
75 Ga0265338_10158401 3300028800 Bacteria 1751
76 Ga0265324_10006713 3300029957 Bacteria 4755
77 Ga0265324_10012052 3300029957 Bacteria 3273
78 Ga0265330_10001241 3300031235 Bacteria 14953
79 Ga0265330_10042191 3300031235 Unclassified 2022
80 Ga0265320_10067630 3300031240 Unclassified 1690
81 Ga0265320_10101821 3300031240 Bacteria 1322
82 Ga0265325_10029735 3300031241 Bacteria 2934
83 Ga0265325_10132877 3300031241 Bacteria 1190
84 Ga0265331_10000373 3300031250 Bacteria 46662
85 Ga0265327_10004780 3300031251 Bacteria 11790
86 Ga0265327_10056879 3300031251 Bacteria 2014
87 Ga0265327_10153090 3300031251 Bacteria 1070
88 Ga0265327_10242412 3300031251 Unclassified 805
89 Ga0265316_10007171 3300031344 Bacteria 10534
90 Ga0265316_10063248 3300031344 Unclassified 2870
91 Ga0265316_10064021 3300031344 Bacteria 2849
92 Ga0265316_10132725 3300031344 Unclassified 1875
93 Ga0265313_10006821 3300031595 Bacteria 7973
94 Ga0265313_10011013 3300031595 Bacteria 5653
95 Ga0265314_10006931 3300031711 Bacteria 9921
96 Ga0265314_10022141 3300031711 Bacteria 4872
97 Ga0265314_10063052 3300031711 Bacteria 2516
98 Ga0265314_10075529 3300031711 Unclassified 2242
99 Ga0265342_10242758 3300031712 Bacteria 964
100 Ga0373928_0079630 3300035084 Unclassified 824
101 Ga0373925_0017511 3300037068 Bacteria 5195
102 Ga0395899_0000039 3300037312 Bacteria 269620
103 Ga0395898_0000226 3300037466 Bacteria 144727
104 Ga0451577_0004031 3300042876 Bacteria 15798
105 Ga0451577_0543593 3300042876 Unclassified 1055
106 Ga0466965_0013143 3300044683 Bacteria 3901
107 Ga0466963_0056067 3300044694 Bacteria 2622
108 Ga0466964_0049958 3300044706 Bacteria 1713
109 Ga0453684_0001047 3300044712 Bacteria 88484
110 Ga0466971_0000005 3300044719 Bacteria 137073
111 Ga0466968_0060948 3300044735 Bacteria 1627
112 Ga0466957_0053798 3300044842 Bacteria 2455
113 Ga0451576_0000132 3300045051 Bacteria 190095
114 Ga0451576_0000314 3300045051 Bacteria 117351
115 Ga0451576_0003268 3300045051 Bacteria 22503
116 Ga0451576_0013592 3300045051 Bacteria 9100
117 Ga0451576_0084216 3300045051 Bacteria 3308
118 Ga0451576_0298698 3300045051 Bacteria 1684
119 Ga0466967_0023024 3300045976 Bacteria 5097
120 Ga0496102_0141002 3300048905 Bacteria 2260
121 Ga0501031_0000635 3300049568 Bacteria 20764
122 Ga0501033_0000003 3300049570 Bacteria 586973
123 Ga0501033_0000015 3300049570 Bacteria 218502
124 Ga0501033_0044608 3300049570 Unclassified 3300
125 Ga0501034_0244613 3300049571 Bacteria 1739
126 Ga0501036_0072697 3300049572 Bacteria 2907
127 Ga0501037_0000295 3300049573 Bacteria 42165
128 Ga0501037_0122287 3300049573 Bacteria 1870
129 Ga0501038_0000480 3300049574 Bacteria 35161
130 Ga0501038_0018195 3300049574 Bacteria 6343
131 Ga0501038_0088044 3300049574 Bacteria 2607
132 Ga0501038_0389776 3300049574 Bacteria 1079
133 Ga0501039_0023647 3300049575 Bacteria 4716
134 Ga0501039_0656036 3300049575 Bacteria 821
135 Ga0501039_0773799 3300049575 Bacteria 749
136 Ga0501043_0074703 3300049579 Bacteria 2662
137 Ga0501043_0201181 3300049579 Bacteria 1546
138 Ga0501043_0619735 3300049579 Bacteria 797
139 Ga0501047_0009121 3300049581 Bacteria 9369
140 Ga0501047_0009730 3300049581 Bacteria 9091
141 Ga0501067_0165263 3300049583 Bacteria 1232
142 Ga0501070_0002360 3300049586 Bacteria 16550
143 Ga0501070_0006350 3300049586 Bacteria 10061
144 Ga0501073_0014501 3300049589 Bacteria 5727
145 Ga0501074_0000217 3300049590 Bacteria 31629
146 Ga0501249_000399 3300049679 Bacteria 11167
147 Ga0501080_0000273 3300049742 Bacteria 38971
148 Ga0501080_0063331 3300049742 Bacteria 3442
149 Ga0501083_0337991 3300049744 Bacteria 979
150 Ga0501035_0000004 3300049822 Bacteria 403650
151 Ga0501035_0084314 3300049822 Unclassified 2803
152 Ga0501044_0000740 3300049823 Bacteria 39382
153 Ga0501044_1169787 3300049823 Bacteria 637
154 Ga0500648_210839 3300053097 Unclassified 964
155 Ga0500556_0000259 3300053104 Bacteria 42382
156 Ga0587070_000773 3300059491 Bacteria 2938
157 Ga0587080_001649 3300059503 Bacteria 2474
158 Ga0587071_001242 3300060344 Bacteria 3094
159 Ga0587071_009191 3300060344 Bacteria 1619
160 Ga0466962_0000007 3300061719 Bacteria 157857

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049823 Ga0501044_1169787 Ga0501044_1169787_23_592 162
2 3300003320 rootH2_10050166 rootH2_1005016623 186
3 3300049574 Ga0501038_0000480 Ga0501038_0000480_7826_8497 186
4 3300049583 Ga0501067_0165263 Ga0501067_0165263_285_956 186
5 3300013297 Ga0157378_10185207 Ga0157378_101852071 190
6 3300014968 Ga0157379_10041594 Ga0157379_100415944 190
7 3300037466 Ga0395898_0000226 Ga0395898_0000226_92878_93552 197
8 3300049568 Ga0501031_0000635 Ga0501031_0000635_437_1114 197
9 3300049572 Ga0501036_0072697 Ga0501036_0072697_631_1308 197
10 3300049574 Ga0501038_0389776 Ga0501038_0389776_347_1024 197
11 3300049575 Ga0501039_0023647 Ga0501039_0023647_1902_2579 197
12 3300049575 Ga0501039_0773799 Ga0501039_0773799_60_737 197
13 3300049579 Ga0501043_0074703 Ga0501043_0074703_242_919 197
14 3300049579 Ga0501043_0619735 Ga0501043_0619735_57_734 197
15 3300049581 Ga0501047_0009121 Ga0501047_0009121_4022_4699 197
16 3300049586 Ga0501070_0002360 Ga0501070_0002360_10482_11159 197
17 3300049822 Ga0501035_0000004 Ga0501035_0000004_10494_11171 197
18 3300001991 JGI24743J22301_10031918 JGI24743J22301_100319182 198
19 3300005355 Ga0070671_100294500 Ga0070671_1002945003 198
20 3300044683 Ga0466965_0013143 Ga0466965_0013143_1875_2552 198
21 3300044694 Ga0466963_0056067 Ga0466963_0056067_1609_2286 198
22 3300044706 Ga0466964_0049958 Ga0466964_0049958_650_1327 198
23 3300044719 Ga0466971_0000005 Ga0466971_0000005_60765_61442 198
24 3300044735 Ga0466968_0060948 Ga0466968_0060948_442_1119 198
25 3300044842 Ga0466957_0053798 Ga0466957_0053798_1374_2051 198
26 3300045976 Ga0466967_0023024 Ga0466967_0023024_1893_2570 198
27 3300049573 Ga0501037_0000295 Ga0501037_0000295_27586_28263 198
28 3300049823 Ga0501044_0000740 Ga0501044_0000740_1656_2333 198
29 3300060344 Ga0587071_009191 Ga0587071_009191_267_944 198
30 3300061719 Ga0466962_0000007 Ga0466962_0000007_139108_139785 198
31 3300002155 JGI24033J26618_1000142 JGI24033J26618_10001421 200
32 3300003322 rootL2_10048990 rootL2_100489903 200
33 3300003323 rootH1_10015537 rootH1_100155372 200
34 3300005344 Ga0070661_100001994 Ga0070661_1000019947 200
35 3300005354 Ga0070675_100185313 Ga0070675_1001853134 200
36 3300005356 Ga0070674_100135982 Ga0070674_1001359822 200
37 3300005366 Ga0070659_100100884 Ga0070659_1001008842 200
38 3300005614 Ga0068856_100004352 Ga0068856_10000435214 200
39 3300013296 Ga0157374_10052238 Ga0157374_100522386 200
40 3300013297 Ga0157378_10001234 Ga0157378_100012349 200
41 3300013308 Ga0157375_10047456 Ga0157375_100474567 200
42 3300025920 Ga0207649_10000215 Ga0207649_1000021543 200
43 3300025926 Ga0207659_10228373 Ga0207659_102283732 200
44 3300026078 Ga0207702_10003580 Ga0207702_1000358012 200
45 3300037312 Ga0395899_0000039 Ga0395899_0000039_166296_166970 200
46 3300048905 Ga0496102_0141002 Ga0496102_0141002_1251_1925 200
47 3300049570 Ga0501033_0000003 Ga0501033_0000003_161625_162299 200
48 3300049579 Ga0501043_0201181 Ga0501043_0201181_720_1394 200
49 3300059491 Ga0587070_000773 Ga0587070_000773_1603_2277 200
50 3300059503 Ga0587080_001649 Ga0587080_001649_1750_2424 200
51 3300060344 Ga0587071_001242 Ga0587071_001242_1921_2595 200
52 3300049570 Ga0501033_0000015 Ga0501033_0000015_64844_65521 201
53 3300049574 Ga0501038_0018195 Ga0501038_0018195_1557_2234 201
54 3300005563 Ga0068855_100519230 Ga0068855_1005192302 210
55 3300005718 Ga0068866_10000010 Ga0068866_1000001079 210
56 3300005719 Ga0068861_100348454 Ga0068861_1003484542 210
57 3300005842 Ga0068858_100073288 Ga0068858_1000732882 210
58 3300009093 Ga0105240_10002329 Ga0105240_1000232917 210
59 3300009176 Ga0105242_10000033 Ga0105242_1000003377 210
60 3300009553 Ga0105249_10015433 Ga0105249_100154334 210
61 3300010375 Ga0105239_10000158 Ga0105239_1000015877 210
62 3300025899 Ga0207642_10000011 Ga0207642_1000001127 210
63 3300025913 Ga0207695_10001546 Ga0207695_1000154619 210
64 3300025934 Ga0207686_10000040 Ga0207686_10000040101 210
65 3300025961 Ga0207712_10010036 Ga0207712_1001003613 210
66 3300026035 Ga0207703_10115588 Ga0207703_101155882 210
67 3300026035 Ga0207703_10889565 Ga0207703_108895652 210
68 3300026118 Ga0207675_100394112 Ga0207675_1003941122 210
69 3300037068 Ga0373925_0017511 Ga0373925_0017511_2099_2731 210
70 3300003323 rootH1_10173523 rootH1_101735233 216
71 3300003320 rootH2_10279320 rootH2_102793202 218
72 3300045051 Ga0451576_0000314 Ga0451576_0000314_53419_54075 218
73 3300049679 Ga0501249_000399 Ga0501249_000399_1265_1921 218
74 3300005364 Ga0070673_100624630 Ga0070673_1006246301 219
75 3300042876 Ga0451577_0004031 Ga0451577_0004031_1345_2004 219
76 3300045051 Ga0451576_0013592 Ga0451576_0013592_4456_5115 219
77 3300031712 Ga0265342_10242758 Ga0265342_102427581 220
78 3300005545 Ga0070695_100562320 Ga0070695_1005623202 221
79 3300028556 Ga0265337_1003046 Ga0265337_10030469 221
80 3300028556 Ga0265337_1075289 Ga0265337_10752892 221
81 3300028577 Ga0265318_10017898 Ga0265318_100178986 221
82 3300028800 Ga0265338_10000380 Ga0265338_1000038022 221
83 3300028800 Ga0265338_10002122 Ga0265338_1000212233 221
84 3300028800 Ga0265338_10158401 Ga0265338_101584014 221
85 3300031241 Ga0265325_10029735 Ga0265325_100297354 221
86 3300031344 Ga0265316_10063248 Ga0265316_100632485 221
87 3300031595 Ga0265313_10006821 Ga0265313_100068218 221
88 3300031711 Ga0265314_10006931 Ga0265314_100069319 221
89 3300053104 Ga0500556_0000259 Ga0500556_0000259_39314_39979 221
90 3300005336 Ga0070680_100089313 Ga0070680_1000893134 222
91 3300005530 Ga0070679_100276871 Ga0070679_1002768712 222
92 3300006358 Ga0068871_100910698 Ga0068871_1009106982 222
93 3300031235 Ga0265330_10042191 Ga0265330_100421913 222
94 3300031240 Ga0265320_10101821 Ga0265320_101018212 222
95 3300005458 Ga0070681_10221940 Ga0070681_102219401 223
96 3300005544 Ga0070686_100013900 Ga0070686_1000139005 223
97 3300028573 Ga0265334_10060017 Ga0265334_100600172 223
98 3300028800 Ga0265338_10000002 Ga0265338_10000002245 223
99 3300028800 Ga0265338_10052804 Ga0265338_100528044 223
100 3300028800 Ga0265338_10124521 Ga0265338_101245215 223
101 3300029957 Ga0265324_10006713 Ga0265324_100067139 223
102 3300029957 Ga0265324_10012052 Ga0265324_100120524 223
103 3300031241 Ga0265325_10132877 Ga0265325_101328772 223
104 3300031344 Ga0265316_10064021 Ga0265316_100640214 223
105 3300035084 Ga0373928_0079630 Ga0373928_0079630_80_754 223
106 3300045051 Ga0451576_0084216 Ga0451576_0084216_1740_2411 223
107 3300045051 Ga0451576_0298698 Ga0451576_0298698_937_1611 223
108 3300005458 Ga0070681_10510811 Ga0070681_105108112 224
109 3300028573 Ga0265334_10025434 Ga0265334_100254341 224
110 3300028800 Ga0265338_10001848 Ga0265338_1000184824 224
111 3300031251 Ga0265327_10153090 Ga0265327_101530902 224
112 3300049571 Ga0501034_0244613 Ga0501034_0244613_290_967 224
113 3300049573 Ga0501037_0122287 Ga0501037_0122287_797_1474 224
114 3300049574 Ga0501038_0088044 Ga0501038_0088044_1626_2303 224
115 3300049575 Ga0501039_0656036 Ga0501039_0656036_115_792 224
116 3300049742 Ga0501080_0000273 Ga0501080_0000273_5976_6653 224
117 3300028800 Ga0265338_10066402 Ga0265338_100664022 226
118 3300031235 Ga0265330_10001241 Ga0265330_100012419 226
119 3300031251 Ga0265327_10004780 Ga0265327_1000478011 226
120 3300031251 Ga0265327_10056879 Ga0265327_100568791 226
121 3300031344 Ga0265316_10007171 Ga0265316_1000717112 226
122 3300044712 Ga0453684_0001047 Ga0453684_0001047_53973_54653 226
123 3300009551 Ga0105238_10000248 Ga0105238_1000024876 227
124 3300028800 Ga0265338_10044087 Ga0265338_100440875 227
125 3300049744 Ga0501083_0337991 Ga0501083_0337991_109_792 227
126 3300025924 Ga0207694_10029616 Ga0207694_100296165 228
127 3300005439 Ga0070711_100019344 Ga0070711_1000193447 229
128 3300025916 Ga0207663_10030267 Ga0207663_100302675 229
129 3300028577 Ga0265318_10043543 Ga0265318_100435434 229
130 3300028800 Ga0265338_10000049 Ga0265338_10000049151 229
131 3300031251 Ga0265327_10242412 Ga0265327_102424121 229
132 3300031711 Ga0265314_10063052 Ga0265314_100630521 229
133 3300045051 Ga0451576_0003268 Ga0451576_0003268_1321_2010 229
134 3300049570 Ga0501033_0044608 Ga0501033_0044608_2003_2695 229
135 3300005336 Ga0070680_100049374 Ga0070680_1000493744 230
136 3300025917 Ga0207660_10150313 Ga0207660_101503132 230
137 3300025921 Ga0207652_10116856 Ga0207652_101168565 230
138 3300028577 Ga0265318_10005814 Ga0265318_100058144 231
139 3300042876 Ga0451577_0543593 Ga0451577_0543593_132_836 231
140 3300045051 Ga0451576_0000132 Ga0451576_0000132_96900_97604 231
141 3300049581 Ga0501047_0009730 Ga0501047_0009730_4999_5697 231
142 3300049586 Ga0501070_0006350 Ga0501070_0006350_6215_6913 231
143 3300049589 Ga0501073_0014501 Ga0501073_0014501_4865_5563 231
144 3300049590 Ga0501074_0000217 Ga0501074_0000217_24455_25153 231
145 3300049742 Ga0501080_0063331 Ga0501080_0063331_308_1006 231
146 3300053097 Ga0500648_210839 Ga0500648_210839_148_852 231
147 3300031250 Ga0265331_10000373 Ga0265331_1000037331 232
148 3300025921 Ga0207652_10031978 Ga0207652_100319783 233
149 3300025949 Ga0207667_10067298 Ga0207667_100672984 233
150 3300028577 Ga0265318_10030189 Ga0265318_100301892 233
151 3300028666 Ga0265336_10000018 Ga0265336_1000001839 233
152 3300028800 Ga0265338_10047320 Ga0265338_100473202 233
153 3300031240 Ga0265320_10067630 Ga0265320_100676303 233
154 3300031344 Ga0265316_10132725 Ga0265316_101327253 233
155 3300031595 Ga0265313_10011013 Ga0265313_100110134 233
156 3300031711 Ga0265314_10022141 Ga0265314_100221416 233
157 3300049822 Ga0501035_0084314 Ga0501035_0084314_1474_2205 233
158 2010549000 RicEn_FSXC77061_b1 RicEn_561620 234
159 3300031711 Ga0265314_10075529 Ga0265314_100755295 234

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00189

Ribosomal_S3_C

Ribosomal protein S3, C-terminal domain

128

211

0.97

PF07650

KH_2

KH domain

39

119

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v66-assembly1.cif.gz_AO structure of the e. coli ribosome and the trnas in post-accommodation state 0.8984 18 216
8cdu-assembly1.cif.gz_E rnase r bound to a 30s degradation intermediate (main state) 0.8953 14 216
7ooc-assembly1.cif.gz_B mycoplasma pneumoniae 30s subunit of ribosomes in chloramphenicol-treated cells 0.8856 18 219
8crx-assembly1.cif.gz_G cutibacterium acnes 70s ribosome with mrna, p-site trna and sarecycline bound 0.8836 5 216
6cae-assembly1.cif.gz_1c crystal structure of the thermus thermophilus 70s ribosome in complex with noso-95179 antibiotic and bound to mrna and a-, p- and e-site trnas at 2.6a resolution 0.879 5 216
ID Description Score Start End Superfamily
af_P0A7V3_109_233_3.30.1140.32 Alpha Beta;2-Layer Sandwich;Ribosomal protein S3 C-terminal domain;Ribosomal protein S3, C-terminal domain 0.9255 117 216 3.30.1140.32
af_P06586_125_224_3.30.1140.32 Alpha Beta;2-Layer Sandwich;Ribosomal protein S3 C-terminal domain;Ribosomal protein S3, C-terminal domain 0.9191 116 215 3.30.1140.32
3huwC02 Alpha Beta;2-Layer Sandwich;Ribosomal protein S3 C-terminal domain;Ribosomal protein S3, C-terminal domain 0.9121 116 216 3.30.1140.32
af_Q2FW12_17_106_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9119 17 115 3.30.300.20
af_P48152_95_238_3.30.1140.32 Alpha Beta;2-Layer Sandwich;Ribosomal protein S3 C-terminal domain;Ribosomal protein S3, C-terminal domain 0.9088 116 212 3.30.1140.32
ID Description Score Start End GO Terms
AF-A0A831TVY5-F1-model_v4 Multifunctional fusion protein [Includes: Small ribosomal subunit protein uS3; Large ribosomal subunit protein uL22] 0.9432 26 216 GO:0003729
GO:0003735
GO:0006412
GO:0015934
GO:0019843
GO:0022627
AF-R5Y203-F1-model_v4 deleted 0.9391 57 216
AF-A0A2H0B9Q7-F1-model_v4 Small ribosomal subunit protein uS3 0.9385 40 216 GO:0003729
GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A7C5A902-F1-model_v4 30S ribosomal protein S3 0.9383 113 215 GO:0003735
GO:0006412
GO:0022627
AF-A0A2H0CSE1-F1-model_v4 Small ribosomal subunit protein uS3 0.9379 20 215 GO:0003729
GO:0003735
GO:0006412
GO:0019843
GO:0022627

Feature Viewer

pLDDT pTM Quality
81.88 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map