F231907

General Info

Members Datasets Scaffolds Average Seq Length
159 123 159 342

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100071551|Ga0075428_1000715512
Length 393
Sequence MTHVAGVNTYVHTEAAVPVRYFQMKPPEGEYSMHKALITGITGQDGSYLAEFLMSKGYEVHGLIRRASTFNTGRVNHLYVDPHDPGAKLFLHYGDLANAEQMTPLIYDMQPQEIYHLGAQSHVRVSFDMPEYTGDVTGLGTTRLLQAIHSSGIQTKFYQASSSEMFGAAPAPQSEHTAFQPQSPYAAAKVYAYWMVVNYRQGHNLFACNGMLFNHESPRRGETFVTRKVTQAVARILAGQQQKLYLGNLEAKRDWGYAPEYVEAMWHMLQQDVPDDYVIGTGETHSVREFVQAAFAYAGLDWREYVEIDPRYFRPTEVACLQADTTKARMQLGWEPKVTFEELIAIMVDADMEALGLQPIGDGQCTLATKCAGWHQWSTAVTALQQGAAHKFE

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
4 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
13 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
53 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
54 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
55 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
79 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
81 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
82 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
83 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
84 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
85 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
86 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
87 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
88 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
89 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
90 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
95 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
96 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
97 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
98 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
99 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
100 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
101 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
102 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
103 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
104 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
105 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
106 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
107 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
108 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
109 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
110 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
116 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
117 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
118 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
119 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
120 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
121 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
122 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
123 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.37
Metatranscriptomes 0.63
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.26
Nodule 0
Rhizoplane 1.89
Rhizosphere 90.57
Stem 0
Stem Tuber 0
Unclassified 6.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10097554 3300005290 Bacteria 2137
2 Ga0070676_10111259 3300005328 Bacteria 1705
3 Ga0070671_100020893 3300005355 Bacteria 5340
4 Ga0070688_100003652 3300005365 Bacteria 7942
5 Ga0070659_100058395 3300005366 Bacteria 3044
6 Ga0070667_100153218 3300005367 Bacteria 2026
7 Ga0070701_10078403 3300005438 Bacteria 1782
8 Ga0070700_100163027 3300005441 Bacteria 1536
9 Ga0068867_100123844 3300005459 Bacteria 2001
10 Ga0070706_100186414 3300005467 Bacteria 1939
11 Ga0070707_100045442 3300005468 Bacteria 4204
12 Ga0070707_100066038 3300005468 Bacteria 3476
13 Ga0070686_100031291 3300005544 Bacteria 3252
14 Ga0070696_100015788 3300005546 Bacteria 5076
15 Ga0070665_100000027 3300005548 Bacteria 359314
16 Ga0070665_100006752 3300005548 Bacteria 11664
17 Ga0070665_100191051 3300005548 Bacteria 2048
18 Ga0070664_100027063 3300005564 Bacteria 4764
19 Ga0068857_100246083 3300005577 Bacteria 1638
20 Ga0068856_100005385 3300005614 Bacteria 12615
21 Ga0068856_100046093 3300005614 Bacteria 4294
22 Ga0068852_100037036 3300005616 Bacteria 4088
23 Ga0068859_100029947 3300005617 Bacteria 5461
24 Ga0068859_100033406 3300005617 Bacteria 5165
25 Ga0068864_100002446 3300005618 Bacteria 15342
26 Ga0068870_10038328 3300005840 Bacteria 2474
27 Ga0068863_100000233 3300005841 Bacteria 58900
28 Ga0068858_100084348 3300005842 Bacteria 2955
29 Ga0068860_100017841 3300005843 Bacteria 6912
30 Ga0081538_10019058 3300005981 Bacteria 5120
31 Ga0081539_10011465 3300005985 Bacteria 6999
32 Ga0081539_10032534 3300005985 Bacteria 3192
33 Ga0070717_10148144 3300006028 Bacteria 2029
34 Ga0070717_10175572 3300006028 Bacteria 1865
35 Ga0075428_100048581 3300006844 Bacteria 4657
36 Ga0075428_100071551 3300006844 Bacteria 3790
37 Ga0075428_100236447 3300006844 Bacteria 1971
38 Ga0075428_100240658 3300006844 Unclassified 1952
39 Ga0068865_100152407 3300006881 Bacteria 1755
40 Ga0075436_100147195 3300006914 Bacteria 1656
41 Ga0097620_100029947 3300006931 Bacteria 5461
42 Ga0097620_100033404 3300006931 Bacteria 5165
43 Ga0105240_10012334 3300009093 Bacteria 11805
44 Ga0111539_10019617 3300009094 Bacteria 8341
45 Ga0111539_10190124 3300009094 Bacteria 2396
46 Ga0105245_10057339 3300009098 Bacteria 3503
47 Ga0105247_10008889 3300009101 Bacteria 6120
48 Ga0114129_10487474 3300009147 Bacteria 1612
49 Ga0105243_10068852 3300009148 Bacteria 2853
50 Ga0105243_10080623 3300009148 Bacteria 2655
51 Ga0105242_10071005 3300009176 Bacteria 2888
52 Ga0105238_10063333 3300009551 Bacteria 3698
53 Ga0105249_10133479 3300009553 Bacteria 2373
54 Ga0157369_10304249 3300013105 Bacteria 1658
55 Ga0157374_10081592 3300013296 Bacteria 3069
56 Ga0157378_10017130 3300013297 Bacteria 6351
57 Ga0163162_10030082 3300013306 Bacteria 5379
58 Ga0157372_10180208 3300013307 Bacteria 2445
59 Ga0157375_10047728 3300013308 Bacteria 4184
60 Ga0163163_10003902 3300014325 Bacteria 12717
61 Ga0157380_10143418 3300014326 Bacteria 2055
62 Ga0157379_10125033 3300014968 Bacteria 2314
63 Ga0157376_10537601 3300014969 Bacteria 1154
64 Ga0163161_10063816 3300017792 Bacteria 2686
65 Ga0163161_10219575 3300017792 Bacteria 1471
66 Ga0213873_10012613 3300021358 Bacteria 1836
67 Ga0213876_10064007 3300021384 Bacteria 1941
68 Ga0213875_10077573 3300021388 Bacteria 1550
69 Ga0207645_10101297 3300025907 Bacteria 1858
70 Ga0207684_10140050 3300025910 Bacteria 2079
71 Ga0207654_10145092 3300025911 Bacteria 1518
72 Ga0207657_10068966 3300025919 Bacteria 3002
73 Ga0207646_10124432 3300025922 Bacteria 2318
74 Ga0207646_10125261 3300025922 Bacteria 2310
75 Ga0207646_10188933 3300025922 Bacteria 1860
76 Ga0207694_10179466 3300025924 Bacteria 1717
77 Ga0207644_10064543 3300025931 Bacteria 2660
78 Ga0207706_10126610 3300025933 Bacteria 2246
79 Ga0207670_10166768 3300025936 Bacteria 1648
80 Ga0207704_10007712 3300025938 Bacteria 5103
81 Ga0207651_10051406 3300025960 Bacteria 2804
82 Ga0207712_10023692 3300025961 Bacteria 4055
83 Ga0207658_10192335 3300025986 Bacteria 1697
84 Ga0207703_10029483 3300026035 Bacteria 4330
85 Ga0207703_10072851 3300026035 Bacteria 2840
86 Ga0207678_10053510 3300026067 Bacteria 3478
87 Ga0207708_10054914 3300026075 Bacteria 3037
88 Ga0207708_10107630 3300026075 Bacteria 2162
89 Ga0207702_10009796 3300026078 Bacteria 8037
90 Ga0207641_10000233 3300026088 Bacteria 71788
91 Ga0207641_10302679 3300026088 Bacteria 1511
92 Ga0207676_10133661 3300026095 Bacteria 2113
93 Ga0207674_10024891 3300026116 Bacteria 6388
94 Ga0207428_10024266 3300027907 Bacteria 5094
95 Ga0207428_10065475 3300027907 Bacteria 2867
96 Ga0268266_10000050 3300028379 Bacteria 302778
97 Ga0268266_10038791 3300028379 Bacteria 4055
98 Ga0268264_10008281 3300028381 Bacteria 8638
99 Ga0265337_1004825 3300028556 Bacteria 5514
100 Ga0265770_1009080 3300030878 Bacteria 1428
101 Ga0265330_10000566 3300031235 Bacteria 24071
102 Ga0265325_10000893 3300031241 Bacteria 21555
103 Ga0265339_10017960 3300031249 Bacteria 4180
104 Ga0265316_10002324 3300031344 Bacteria 19880
105 Ga0265313_10007632 3300031595 Bacteria 7337
106 Ga0265342_10000688 3300031712 Bacteria 35355
107 Ga0265342_10082919 3300031712 Bacteria 1849
108 Ga0316576_10275005 3300031727 Bacteria 1262
109 Ga0316577_10095259 3300031733 Bacteria 1667
110 Ga0307406_10323989 3300031901 Bacteria 1193
111 Ga0373937_0037729 3300036401 Bacteria 4404
112 Ga0316582_0018403 3300036647 Bacteria 4066
113 Ga0316582_0238208 3300036647 Bacteria 1246
114 Ga0395905_0068425 3300037471 Bacteria 3326
115 Ga0436364_0093057 3300037853 Bacteria 6447
116 Ga0436364_0647184 3300037853 Bacteria 11156
117 Ga0436364_1297266 3300037853 Bacteria 4456
118 Ga0436364_1316340 3300037853 Bacteria 2756
119 Ga0395901_0046053 3300038443 Bacteria 4529
120 Ga0436365_0039623 3300039437 Bacteria 3156
121 Ga0436363_0235371 3300039450 Bacteria 2606
122 Ga0436363_1136406 3300039450 Bacteria 6999
123 Ga0436362_0340527 3300039453 Bacteria 12975
124 Ga0436362_0490025 3300039453 Bacteria 1065
125 Ga0453683_0021455 3300044673 Bacteria 4124
126 Ga0466963_0051281 3300044694 Bacteria 2735
127 Ga0453684_0000272 3300044712 Archaea 222816
128 Ga0453684_0000898 3300044712 Archaea 99227
129 Ga0453684_0008174 3300044712 Archaea 18876
130 Ga0453684_0025613 3300044712 Archaea 8560
131 Ga0453684_0038327 3300044712 Archaea 6555
132 Ga0453684_0063003 3300044712 Bacteria 4746
133 Ga0453684_0110899 3300044712 Bacteria 3333
134 Ga0453684_0295587 3300044712 Bacteria 1842
135 Ga0453684_0314497 3300044712 Bacteria 1775
136 Ga0451576_0049226 3300045051 Bacteria 4422
137 Ga0466967_0477146 3300045976 Bacteria 1221
138 Ga0495630_0001516 3300046517 Bacteria 16077
139 Ga0495640_0014145 3300046533 Bacteria 6049
140 Ga0495634_0010704 3300046642 Bacteria 6713
141 Ga0495676_0181415 3300047321 Bacteria 1475
142 Ga0496109_0243572 3300048912 Bacteria 1692
143 Ga0496111_0185018 3300048914 Bacteria 1549
144 Ga0496112_0025377 3300048915 Bacteria 5691
145 Ga0496125_0000015 3300048928 Bacteria 516648
146 Ga0501036_0149240 3300049572 Bacteria 1972
147 Ga0501037_0014178 3300049573 Bacteria 5868
148 Ga0501039_0076827 3300049575 Bacteria 2596
149 Ga0501041_0059392 3300049577 Bacteria 2340
150 Ga0501042_0003674 3300049578 Bacteria 9673
151 Ga0501076_0178923 3300049592 Bacteria 1729
152 Ga0501080_0204487 3300049742 Bacteria 1812
153 Ga0501035_0042161 3300049822 Bacteria 4117
154 nmdc:mga00v17_57969_c1 3300050491 Bacteria 2370
155 nmdc:mga09592_300374_c1 3300050508 Bacteria 1392
156 nmdc:mga08y16_197886_c1 3300050511 Bacteria 2083
157 nmdc:mga08x19_129380_c1 3300050514 Bacteria 1697
158 Ga0500643_000671 3300053087 Bacteria 22910
159 Ga0530510_0026450 3300061734 Bacteria 4154

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009094 Ga0111539_10190124 Ga0111539_101901241 300
2 3300009098 Ga0105245_10057339 Ga0105245_100573393 300
3 3300050511 nmdc:mga08y16_197886_c1 nmdc:mga08y16_197886_c1_148_1170 300
4 3300005981 Ga0081538_10019058 Ga0081538_100190587 305
5 3300039453 Ga0436362_0490025 Ga0436362_0490025_54_1043 305
6 3300005459 Ga0068867_100123844 Ga0068867_1001238442 316
7 3300006881 Ga0068865_100152407 Ga0068865_1001524072 316
8 3300009148 Ga0105243_10068852 Ga0105243_100688523 316
9 3300009176 Ga0105242_10071005 Ga0105242_100710052 316
10 3300009551 Ga0105238_10063333 Ga0105238_100633333 316
11 3300009553 Ga0105249_10133479 Ga0105249_101334792 316
12 3300013297 Ga0157378_10017130 Ga0157378_100171305 316
13 3300014969 Ga0157376_10537601 Ga0157376_105376011 316
14 3300025924 Ga0207694_10179466 Ga0207694_101794662 316
15 3300025938 Ga0207704_10007712 Ga0207704_100077124 316
16 3300021388 Ga0213875_10077573 Ga0213875_100775732 317
17 3300005355 Ga0070671_100020893 Ga0070671_1000208932 319
18 3300005546 Ga0070696_100015788 Ga0070696_1000157882 319
19 3300005843 Ga0068860_100017841 Ga0068860_1000178412 319
20 3300006844 Ga0075428_100048581 Ga0075428_1000485814 319
21 3300025922 Ga0207646_10124432 Ga0207646_101244322 319
22 3300025931 Ga0207644_10064543 Ga0207644_100645432 319
23 3300028381 Ga0268264_10008281 Ga0268264_100082815 319
24 3300049592 Ga0501076_0178923 Ga0501076_0178923_593_1588 319
25 3300050508 nmdc:mga09592_300374_c1 nmdc:mga09592_300374_c1_349_1344 319
26 3300005468 Ga0070707_100066038 Ga0070707_1000660382 320
27 3300025910 Ga0207684_10140050 Ga0207684_101400501 320
28 3300025922 Ga0207646_10188933 Ga0207646_101889332 320
29 3300005467 Ga0070706_100186414 Ga0070706_1001864142 321
30 3300005544 Ga0070686_100031291 Ga0070686_1000312912 321
31 3300005548 Ga0070665_100006752 Ga0070665_10000675210 321
32 3300005577 Ga0068857_100246083 Ga0068857_1002460832 321
33 3300005985 Ga0081539_10011465 Ga0081539_100114653 321
34 3300005985 Ga0081539_10032534 Ga0081539_100325342 321
35 3300006914 Ga0075436_100147195 Ga0075436_1001471951 321
36 3300009094 Ga0111539_10019617 Ga0111539_100196176 321
37 3300009147 Ga0114129_10487474 Ga0114129_104874742 321
38 3300013306 Ga0163162_10030082 Ga0163162_100300822 321
39 3300013308 Ga0157375_10047728 Ga0157375_100477281 321
40 3300014325 Ga0163163_10003902 Ga0163163_100039025 321
41 3300014968 Ga0157379_10125033 Ga0157379_101250333 321
42 3300017792 Ga0163161_10219575 Ga0163161_102195751 321
43 3300025961 Ga0207712_10023692 Ga0207712_100236923 321
44 3300026035 Ga0207703_10072851 Ga0207703_100728511 321
45 3300026075 Ga0207708_10054914 Ga0207708_100549143 321
46 3300026088 Ga0207641_10302679 Ga0207641_103026791 321
47 3300027907 Ga0207428_10065475 Ga0207428_100654751 321
48 3300028379 Ga0268266_10038791 Ga0268266_100387913 321
49 3300031235 Ga0265330_10000566 Ga0265330_100005663 321
50 3300031241 Ga0265325_10000893 Ga0265325_1000089314 321
51 3300031249 Ga0265339_10017960 Ga0265339_100179602 321
52 3300031344 Ga0265316_10002324 Ga0265316_100023244 321
53 3300031595 Ga0265313_10007632 Ga0265313_100076323 321
54 3300031712 Ga0265342_10000688 Ga0265342_1000068820 321
55 3300031712 Ga0265342_10082919 Ga0265342_100829192 321
56 3300031727 Ga0316576_10275005 Ga0316576_102750052 321
57 3300031901 Ga0307406_10323989 Ga0307406_103239891 321
58 3300036401 Ga0373937_0037729 Ga0373937_0037729_2305_3288 321
59 3300036647 Ga0316582_0238208 Ga0316582_0238208_52_1119 321
60 3300037471 Ga0395905_0068425 Ga0395905_0068425_21_1010 321
61 3300038443 Ga0395901_0046053 Ga0395901_0046053_638_1627 321
62 3300044673 Ga0453683_0021455 Ga0453683_0021455_1119_2174 321
63 3300044694 Ga0466963_0051281 Ga0466963_0051281_558_1580 321
64 3300044712 Ga0453684_0063003 Ga0453684_0063003_2104_3132 321
65 3300044712 Ga0453684_0110899 Ga0453684_0110899_759_1832 321
66 3300045051 Ga0451576_0049226 Ga0451576_0049226_2983_4056 321
67 3300048915 Ga0496112_0025377 Ga0496112_0025377_3461_4567 321
68 3300049572 Ga0501036_0149240 Ga0501036_0149240_260_1282 321
69 3300049573 Ga0501037_0014178 Ga0501037_0014178_1051_2073 321
70 3300049575 Ga0501039_0076827 Ga0501039_0076827_1392_2414 321
71 3300049577 Ga0501041_0059392 Ga0501041_0059392_982_2004 321
72 3300049578 Ga0501042_0003674 Ga0501042_0003674_7487_8509 321
73 3300049822 Ga0501035_0042161 Ga0501035_0042161_2453_3475 321
74 3300005468 Ga0070707_100045442 Ga0070707_1000454423 322
75 3300005564 Ga0070664_100027063 Ga0070664_1000270634 322
76 3300005614 Ga0068856_100005385 Ga0068856_1000053851 322
77 3300005614 Ga0068856_100046093 Ga0068856_1000460933 322
78 3300006028 Ga0070717_10148144 Ga0070717_101481442 322
79 3300006844 Ga0075428_100236447 Ga0075428_1002364472 322
80 3300006844 Ga0075428_100240658 Ga0075428_1002406581 322
81 3300013105 Ga0157369_10304249 Ga0157369_103042492 322
82 3300013296 Ga0157374_10081592 Ga0157374_100815921 322
83 3300013307 Ga0157372_10180208 Ga0157372_101802082 322
84 3300025922 Ga0207646_10125261 Ga0207646_101252611 322
85 3300026078 Ga0207702_10009796 Ga0207702_100097969 322
86 3300037853 Ga0436364_1316340 Ga0436364_1316340_484_1527 322
87 3300044712 Ga0453684_0000272 Ga0453684_0000272_2281_3327 322
88 3300044712 Ga0453684_0000898 Ga0453684_0000898_3555_4601 322
89 3300044712 Ga0453684_0008174 Ga0453684_0008174_17134_18180 322
90 3300044712 Ga0453684_0025613 Ga0453684_0025613_3038_4084 322
91 3300044712 Ga0453684_0038327 Ga0453684_0038327_2346_3392 322
92 3300044712 Ga0453684_0314497 Ga0453684_0314497_629_1675 322
93 3300048928 Ga0496125_0000015 Ga0496125_0000015_250693_251676 322
94 3300049742 Ga0501080_0204487 Ga0501080_0204487_416_1507 322
95 3300053087 Ga0500643_000671 Ga0500643_000671_6945_7979 322
96 3300061734 Ga0530510_0026450 Ga0530510_0026450_614_1705 322
97 3300005328 Ga0070676_10111259 Ga0070676_101112591 323
98 3300005365 Ga0070688_100003652 Ga0070688_1000036529 323
99 3300005366 Ga0070659_100058395 Ga0070659_1000583953 323
100 3300005367 Ga0070667_100153218 Ga0070667_1001532182 323
101 3300005438 Ga0070701_10078403 Ga0070701_100784031 323
102 3300005441 Ga0070700_100163027 Ga0070700_1001630271 323
103 3300005548 Ga0070665_100000027 Ga0070665_10000002722 323
104 3300005548 Ga0070665_100191051 Ga0070665_1001910512 323
105 3300005616 Ga0068852_100037036 Ga0068852_1000370362 323
106 3300005617 Ga0068859_100029947 Ga0068859_1000299473 323
107 3300005617 Ga0068859_100033406 Ga0068859_1000334066 323
108 3300005618 Ga0068864_100002446 Ga0068864_1000024466 323
109 3300005840 Ga0068870_10038328 Ga0068870_100383282 323
110 3300005841 Ga0068863_100000233 Ga0068863_10000023319 323
111 3300005842 Ga0068858_100084348 Ga0068858_1000843481 323
112 3300006028 Ga0070717_10175572 Ga0070717_101755722 323
113 3300006844 Ga0075428_100071551 Ga0075428_1000715512 323
114 3300006931 Ga0097620_100029947 Ga0097620_1000299473 323
115 3300006931 Ga0097620_100033404 Ga0097620_1000334046 323
116 3300009093 Ga0105240_10012334 Ga0105240_100123346 323
117 3300009101 Ga0105247_10008889 Ga0105247_100088895 323
118 3300009148 Ga0105243_10080623 Ga0105243_100806232 323
119 3300014326 Ga0157380_10143418 Ga0157380_101434181 323
120 3300017792 Ga0163161_10063816 Ga0163161_100638164 323
121 3300021358 Ga0213873_10012613 Ga0213873_100126132 323
122 3300021384 Ga0213876_10064007 Ga0213876_100640072 323
123 3300025907 Ga0207645_10101297 Ga0207645_101012972 323
124 3300025911 Ga0207654_10145092 Ga0207654_101450921 323
125 3300025919 Ga0207657_10068966 Ga0207657_100689661 323
126 3300025933 Ga0207706_10126610 Ga0207706_101266102 323
127 3300025936 Ga0207670_10166768 Ga0207670_101667681 323
128 3300025960 Ga0207651_10051406 Ga0207651_100514063 323
129 3300025986 Ga0207658_10192335 Ga0207658_101923352 323
130 3300026035 Ga0207703_10029483 Ga0207703_100294833 323
131 3300026067 Ga0207678_10053510 Ga0207678_100535101 323
132 3300026075 Ga0207708_10107630 Ga0207708_101076302 323
133 3300026088 Ga0207641_10000233 Ga0207641_1000023341 323
134 3300026095 Ga0207676_10133661 Ga0207676_101336611 323
135 3300026116 Ga0207674_10024891 Ga0207674_100248917 323
136 3300027907 Ga0207428_10024266 Ga0207428_100242661 323
137 3300028379 Ga0268266_10000050 Ga0268266_10000050260 323
138 3300030878 Ga0265770_1009080 Ga0265770_10090802 323
139 3300037853 Ga0436364_0093057 Ga0436364_0093057_431_1495 323
140 3300037853 Ga0436364_0647184 Ga0436364_0647184_1872_2900 323
141 3300037853 Ga0436364_1297266 Ga0436364_1297266_1178_2266 323
142 3300039437 Ga0436365_0039623 Ga0436365_0039623_511_1575 323
143 3300039450 Ga0436363_0235371 Ga0436363_0235371_314_1369 323
144 3300039450 Ga0436363_1136406 Ga0436363_1136406_5031_6095 323
145 3300039453 Ga0436362_0340527 Ga0436362_0340527_11332_12396 323
146 3300044712 Ga0453684_0295587 Ga0453684_0295587_304_1383 323
147 3300045976 Ga0466967_0477146 Ga0466967_0477146_15_1052 323
148 3300046517 Ga0495630_0001516 Ga0495630_0001516_10980_11996 323
149 3300046533 Ga0495640_0014145 Ga0495640_0014145_2049_3065 323
150 3300046642 Ga0495634_0010704 Ga0495634_0010704_3076_4092 323
151 3300047321 Ga0495676_0181415 Ga0495676_0181415_286_1302 323
152 3300048912 Ga0496109_0243572 Ga0496109_0243572_26_1042 323
153 3300048914 Ga0496111_0185018 Ga0496111_0185018_104_1141 323
154 3300050491 nmdc:mga00v17_57969_c1 nmdc:mga00v17_57969_c1_165_1178 323
155 3300050514 nmdc:mga08x19_129380_c1 nmdc:mga08x19_129380_c1_43_1143 323
156 3300005290 Ga0065712_10097554 Ga0065712_100975541 324
157 3300028556 Ga0265337_1004825 Ga0265337_10048256 324
158 3300031733 Ga0316577_10095259 Ga0316577_100952592 324
159 3300036647 Ga0316582_0018403 Ga0316582_0018403_1110_2123 324

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

36

280

0.99

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

37

347

0.98

PF04321

RmlD_sub_bind

RmlD substrate binding domain

33

242

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rpn-assembly3.cif.gz_C crystal structure of gdp-d-mannose 4,6-dehydratase in complexes with gdp and nadph 0.9902 3 324
1rpn-assembly3.cif.gz_C crystal structure of gdp-d-mannose 4,6-dehydratase in complexes with gdp and nadph 0.9872 3 324
2z95-assembly1.cif.gz_D crystal structure of gdp-d-mannose dehydratase from aquifex aeolicus vf5 0.9745 3 320
1n7h-assembly1.cif.gz_B-2 crystal structure of gdp-mannose 4,6-dehydratase ternary complex with nadph and gdp 0.9736 4 323
1n7g-assembly1.cif.gz_B crystal structure of the gdp-mannose 4,6-dehydratase ternary complex with nadph and gdp-rhamnose. 0.9719 4 323
ID Description Score Start End Superfamily
af_P0AC88_3_270_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.966 4 262 3.40.50.720
af_F1QPT3_45_368_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9654 27 317 3.40.50.720
af_Q4D941_50_182_3.90.25.10 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9594 187 300 3.90.25.10
1n7gB01 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9399 187 323 3.90.25.10
1rpnA02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9337 187 324 3.90.25.10
ID Description Score Start End GO Terms
AF-A0A146LA67-F1-model_v4 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) (GDP-D-mannose dehydratase) 0.9977 119 265 GO:0008446
GO:0042351
AF-Q7WSX2-F1-model_v4 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) 0.997 155 265 GO:0008446
GO:0042351
AF-A0A287VKI9-F1-model_v4 deleted 0.995 153 262
AF-X0UM79-F1-model_v4 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) 0.9916 98 294 GO:0008446
GO:0042351
AF-A0A846NYP9-F1-model_v4 deleted 0.9883 146 322

Feature Viewer

pLDDT pTM Quality
95.41 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map