F231052

General Info

Members Datasets Scaffolds Average Seq Length
159 114 319 107

Family's Representative Sequence

Representative Sequence 3300003187|JGI25151J46595_10015728|JGI25151J46595_100157282
Length 127
Sequence MTNPEMKSFLTSLRSKPLAQMQXEVDDYISQFKEGYFSPLAMLARLSEEVGELAREVNHRXGEKPKKASEEDNSIEMELGDILFILLCFSNSLGIDLTKAHDACMHKFNTRDANRWTRIDEQTSDES

Samples

Sample ID Description Type Environment
1 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
4 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
22 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
23 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
24 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
26 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
32 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
33 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
35 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
50 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
53 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
54 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
55 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
56 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
57 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
58 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
59 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
60 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
61 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
62 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
63 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
64 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
65 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
66 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
67 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
68 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
69 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
70 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
71 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
72 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
73 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
74 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
75 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
76 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
77 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
78 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
79 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
80 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
81 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
82 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
83 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
84 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
85 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
86 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
87 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
88 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
89 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
90 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
91 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
92 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
93 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
94 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
95 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
96 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
97 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
98 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
99 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
100 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
101 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
102 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
103 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
104 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
105 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
106 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
107 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
108 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
109 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
110 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
111 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
112 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
113 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
114 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.48
Metatranscriptomes 0
Isolates 2.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.14
Nodule 0
Rhizoplane 3.77
Rhizosphere 87.42
Stem 0
Stem Tuber 0
Unclassified 17.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10015728 3300003187 Bacteria 3323
2 rootH1_10010450 3300003316 Bacteria 2142
3 rootH1_10010450 3300003323 Bacteria 64322
4 Ga0055535_1004015 3300003761 Bacteria 3808
5 Ga0055541_1000215 3300003841 Bacteria 24178
6 Ga0070661_101118952 3300005344 Bacteria 657
7 Ga0070659_100059461 3300005366 Unclassified 3018
8 Ga0070705_100142439 3300005440 Bacteria 1579
9 Ga0070694_100038413 3300005444 Bacteria 3181
10 Ga0070694_100112396 3300005444 Bacteria 1942
11 Ga0070708_100002078 3300005445 Bacteria 15447
12 Ga0070708_100168013 3300005445 Bacteria 2047
13 Ga0070706_100006669 3300005467 Bacteria 10893
14 Ga0070706_100008344 3300005467 Bacteria 9649
15 Ga0070707_100001626 3300005468 Bacteria 21789
16 Ga0070707_100273372 3300005468 Bacteria 1642
17 Ga0070698_100006039 3300005471 Bacteria 13191
18 Ga0070699_100197761 3300005518 Bacteria 1787
19 Ga0070697_100027549 3300005536 Bacteria 4547
20 Ga0070697_100200492 3300005536 Bacteria 1696
21 Ga0070695_101213860 3300005545 Unclassified 621
22 Ga0070696_100067785 3300005546 Bacteria 2504
23 Ga0070696_100679310 3300005546 Bacteria 837
24 Ga0070704_100008015 3300005549 Bacteria 6308
25 Ga0070704_100009222 3300005549 Bacteria 5952
26 Ga0070704_101255977 3300005549 Bacteria 677
27 Ga0070664_101071536 3300005564 Bacteria 758
28 Ga0068857_102034836 3300005577 Bacteria 563
29 Ga0068857_102542099 3300005577 Bacteria 503
30 Ga0068859_100646475 3300005617 Unclassified 1150
31 Ga0075433_10003208 3300006852 Bacteria 12612
32 Ga0075433_10041329 3300006852 Bacteria 3994
33 Ga0075434_100000674 3300006871 Bacteria 26554
34 Ga0075434_100066732 3300006871 Bacteria 3584
35 Ga0075436_100156102 3300006914 Bacteria 1607
36 Ga0097620_100646506 3300006931 Unclassified 1150
37 Ga0075435_100037888 3300007076 Bacteria 3842
38 Ga0099794_10025972 3300007265 Unclassified 2703
39 Ga0099794_10569658 3300007265 Bacteria 598
40 Ga0111539_10461920 3300009094 Bacteria 1478
41 Ga0114129_10068394 3300009147 Bacteria 4952
42 Ga0114129_11438052 3300009147 Unclassified 849
43 Ga0114129_12213801 3300009147 Unclassified 661
44 Ga0105242_12786331 3300009176 Bacteria 539
45 Ga0105249_10220885 3300009553 Bacteria 1864
46 Ga0105249_12553147 3300009553 Bacteria 583
47 Ga0157380_10980788 3300014326 Bacteria 877
48 Ga0163161_10332128 3300017792 Bacteria 1204
49 Ga0209566_100015 3300025225 Bacteria 457963
50 Ga0209025_1045989 3300025294 Bacteria 1802
51 Ga0207653_10007935 3300025885 Bacteria 3308
52 Ga0207653_10076085 3300025885 Unclassified 1154
53 Ga0207684_10011965 3300025910 Bacteria 7557
54 Ga0207684_10064432 3300025910 Bacteria 3111
55 Ga0207707_10281728 3300025912 Bacteria 1440
56 Ga0207693_10441595 3300025915 Bacteria 1017
57 Ga0207646_10014397 3300025922 Bacteria 7513
58 Ga0207646_10015461 3300025922 Bacteria 7207
59 Ga0207646_10053181 3300025922 Bacteria 3622
60 Ga0207690_10042414 3300025932 Unclassified 2988
61 Ga0207690_10302624 3300025932 Bacteria 1252
62 Ga0207691_11668440 3300025940 Bacteria 517
63 Ga0207661_10594175 3300025944 Bacteria 1016
64 Ga0207679_10350881 3300025945 Bacteria 1286
65 Ga0207712_11812774 3300025961 Bacteria 547
66 Ga0207674_10492287 3300026116 Unclassified 1185
67 Ga0209995_1021009 3300027471 Unclassified 1081
68 Ga0209968_1028251 3300027526 Bacteria 931
69 Ga0209999_1034223 3300027543 Bacteria 945
70 Ga0209970_1119161 3300027614 Bacteria 510
71 Ga0209971_1111429 3300027682 Bacteria 671
72 Ga0209966_1073403 3300027695 Bacteria 752
73 Ga0209974_10117986 3300027876 Bacteria 938
74 Ga0209974_10137402 3300027876 Unclassified 875
75 Ga0307408_100085644 3300031548 Bacteria 2367
76 Ga0307408_100088652 3300031548 Bacteria 2331
77 Ga0307408_101003213 3300031548 Bacteria 769
78 Ga0307405_10538236 3300031731 Bacteria 943
79 Ga0307410_11256736 3300031852 Unclassified 646
80 Ga0307406_10322895 3300031901 Bacteria 1195
81 Ga0307406_10534454 3300031901 Unclassified 956
82 Ga0307406_11570004 3300031901 Bacteria 581
83 Ga0307407_11157881 3300031903 Bacteria 603
84 Ga0307409_101459291 3300031995 Unclassified 711
85 Ga0307416_100034879 3300032002 Bacteria 3835
86 Ga0307414_10039860 3300032004 Bacteria 3168
87 Ga0307411_10480471 3300032005 Bacteria 1046
88 Ga0395900_0915204 3300037418 Bacteria 800
89 Ga0395905_0149445 3300037471 Bacteria 2198
90 Ga0439436_0044766 3300041404 Bacteria 1260
91 Ga0439439_0003039 3300041406 Bacteria 3655
92 Ga0439439_0005931 3300041406 Bacteria 2813
93 Ga0451789_1334189 3300041443 Bacteria 656
94 Ga0451793_0630030 3300041452 Unclassified 602
95 Ga0451807_1349156 3300041486 Bacteria 1344
96 Ga0451845_0966438 3300041501 Bacteria 928
97 Ga0451849_0853213 3300041505 Unclassified 880
98 Ga0451855_1930943 3300041511 Bacteria 628
99 Ga0439433_0041977 3300041999 Bacteria 1066
100 Ga0439449_0000163 3300042007 Bacteria 22802
101 Ga0439457_044460 3300042014 Bacteria 991
102 Ga0439462_0000113 3300042015 Bacteria 12637
103 Ga0450890_013295 3300042127 Bacteria 1073
104 Ga0450891_031715 3300042129 Bacteria 549
105 Ga0439446_0112628 3300042156 Bacteria 869
106 Ga0439446_0348750 3300042156 Bacteria 527
107 Ga0451577_0526912 3300042876 Bacteria 1073
108 Ga0453683_0276606 3300044673 Unclassified 1072
109 Ga0453683_0484262 3300044673 Bacteria 802
110 Ga0451576_0046303 3300045051 Bacteria 4580
111 Ga0451576_0173381 3300045051 Bacteria 2251
112 Ga0495580_0637935 3300046472 Bacteria 701
113 Ga0495613_1087016 3300046689 Bacteria 511
114 Ga0495670_0583337 3300046691 Unclassified 609
115 Ga0495593_0554015 3300047673 Bacteria 577
116 Ga0496102_0065398 3300048905 Bacteria 3333
117 Ga0496107_1007740 3300048910 Bacteria 604
118 Ga0496109_1047698 3300048912 Unclassified 753
119 Ga0496119_0481169 3300048922 Bacteria 580
120 Ga0496122_0067063 3300048925 Bacteria 2587
121 Ga0501298_152582 3300049521 Bacteria 566
122 Ga0501067_0002788 3300049583 Bacteria 9612
123 Ga0501067_0503845 3300049583 Bacteria 677
124 Ga0501070_0408196 3300049586 Unclassified 1098
125 Ga0501074_0785769 3300049590 Bacteria 671
126 Ga0501076_1174420 3300049592 Bacteria 632
127 Ga0501217_017401 3300049661 Bacteria 1657
128 Ga0501217_029201 3300049661 Bacteria 1347
129 Ga0501235_099445 3300049669 Bacteria 709
130 Ga0501221_056640 3300049704 Bacteria 896
131 Ga0501079_0343877 3300049741 Bacteria 1169
132 Ga0501079_0720417 3300049741 Bacteria 785
133 Ga0501080_0429218 3300049742 Bacteria 1186
134 Ga0501268_018716 3300049765 Bacteria 1167
135 Ga0501271_062815 3300049768 Bacteria 524
136 Ga0501045_0900428 3300049824 Bacteria 650
137 Ga0501045_0991446 3300049824 Bacteria 616
138 nmdc:mga05p37_1068962_c1 3300050507 Unclassified 849
139 nmdc:mga05p37_200183_c1 3300050507 Unclassified 2419
140 nmdc:mga06r32_504834_c1 3300050510 Unclassified 1186
141 nmdc:mga0n895_2046_c1 3300050512 Bacteria 15516
142 nmdc:mga0n895_42813_c1 3300050512 Bacteria 4408
143 nmdc:mga0n895_472346_c1 3300050512 Unclassified 1265
144 nmdc:mga0n895_62385_c1 3300050512 Bacteria 3684
145 nmdc:mga0n895_756_c1 3300050512 Bacteria 22884
146 nmdc:mga0rr50_1077695_c1 3300050513 Bacteria 684
147 nmdc:mga0rr50_145388_c1 3300050513 Unclassified 1911
148 nmdc:mga0rr50_302264_c1 3300050513 Unclassified 1339
149 nmdc:mga0rr50_73280_c1 3300050513 Unclassified 2618
150 nmdc:mga08x19_15026_c1 3300050514 Bacteria 2760
151 nmdc:mga0a205_104701_c1 3300050515 Bacteria 2728
152 nmdc:mga0a205_18714_c1 3300050515 Bacteria 6519
153 nmdc:mga0a205_188326_c1 3300050515 Bacteria 1956
154 nmdc:mga0a205_41_c1 3300050515 Bacteria 71145
155 nmdc:mga0a205_960372_c1 3300050515 Bacteria 701
156 Ga0501082_0699945 3300060353 Bacteria 887
157 2888581199 2888578766 Bacteria 6743310
158 2904115722 2904113452 Bacteria 7796941
159 2925330930 2925326138 Bacteria 9652120
160 2980126931 2980125574 Bacteria 5567337
161 JGI25151J46595_10015728
162 rootH1_10010450
163 Ga0055535_1004015
164 Ga0055541_1000215
165 Ga0070661_101118952
166 Ga0070659_100059461
167 Ga0070705_100142439
168 Ga0070694_100038413
169 Ga0070694_100112396
170 Ga0070708_100002078
171 Ga0070708_100168013
172 Ga0070706_100006669
173 Ga0070706_100008344
174 Ga0070707_100001626
175 Ga0070707_100273372
176 Ga0070698_100006039
177 Ga0070699_100197761
178 Ga0070697_100027549
179 Ga0070697_100200492
180 Ga0070695_101213860
181 Ga0070696_100067785
182 Ga0070696_100679310
183 Ga0070704_100008015
184 Ga0070704_100009222
185 Ga0070704_101255977
186 Ga0070664_101071536
187 Ga0068857_102034836
188 Ga0068857_102542099
189 Ga0068859_100646475
190 Ga0075433_10003208
191 Ga0075433_10041329
192 Ga0075434_100000674
193 Ga0075434_100066732
194 Ga0075436_100156102
195 Ga0097620_100646506
196 Ga0075435_100037888
197 Ga0099794_10025972
198 Ga0099794_10569658
199 Ga0111539_10461920
200 Ga0114129_10068394
201 Ga0114129_11438052
202 Ga0114129_12213801
203 Ga0105242_12786331
204 Ga0105249_10220885
205 Ga0105249_12553147
206 Ga0157380_10980788
207 Ga0163161_10332128
208 Ga0209566_100015
209 Ga0209025_1045989
210 Ga0207653_10007935
211 Ga0207653_10076085
212 Ga0207684_10011965
213 Ga0207684_10064432
214 Ga0207707_10281728
215 Ga0207693_10441595
216 Ga0207646_10014397
217 Ga0207646_10015461
218 Ga0207646_10053181
219 Ga0207690_10042414
220 Ga0207690_10302624
221 Ga0207691_11668440
222 Ga0207661_10594175
223 Ga0207679_10350881
224 Ga0207712_11812774
225 Ga0207674_10492287
226 Ga0209995_1021009
227 Ga0209968_1028251
228 Ga0209999_1034223
229 Ga0209970_1119161
230 Ga0209971_1111429
231 Ga0209966_1073403
232 Ga0209974_10117986
233 Ga0209974_10137402
234 Ga0307408_100085644
235 Ga0307408_100088652
236 Ga0307408_101003213
237 Ga0307405_10538236
238 Ga0307410_11256736
239 Ga0307406_10322895
240 Ga0307406_10534454
241 Ga0307406_11570004
242 Ga0307407_11157881
243 Ga0307409_101459291
244 Ga0307416_100034879
245 Ga0307414_10039860
246 Ga0307411_10480471
247 Ga0395900_0915204
248 Ga0395905_0149445
249 Ga0439436_0044766
250 Ga0439439_0003039
251 Ga0439439_0005931
252 Ga0451789_1334189
253 Ga0451793_0630030
254 Ga0451807_1349156
255 Ga0451845_0966438
256 Ga0451849_0853213
257 Ga0451855_1930943
258 Ga0439433_0041977
259 Ga0439449_0000163
260 Ga0439457_044460
261 Ga0439462_0000113
262 Ga0450890_013295
263 Ga0450891_031715
264 Ga0439446_0112628
265 Ga0439446_0348750
266 Ga0451577_0526912
267 Ga0453683_0276606
268 Ga0453683_0484262
269 Ga0451576_0046303
270 Ga0451576_0173381
271 Ga0495580_0637935
272 Ga0495613_1087016
273 Ga0495670_0583337
274 Ga0495593_0554015
275 Ga0496102_0065398
276 Ga0496107_1007740
277 Ga0496109_1047698
278 Ga0496119_0481169
279 Ga0496122_0067063
280 Ga0501298_152582
281 Ga0501067_0002788
282 Ga0501067_0503845
283 Ga0501070_0408196
284 Ga0501074_0785769
285 Ga0501076_1174420
286 Ga0501217_017401
287 Ga0501217_029201
288 Ga0501235_099445
289 Ga0501221_056640
290 Ga0501079_0343877
291 Ga0501079_0720417
292 Ga0501080_0429218
293 Ga0501268_018716
294 Ga0501271_062815
295 Ga0501045_0900428
296 Ga0501045_0991446
297 nmdc:mga05p37_1068962_c1
298 nmdc:mga05p37_200183_c1
299 nmdc:mga06r32_504834_c1
300 nmdc:mga0n895_2046_c1
301 nmdc:mga0n895_42813_c1
302 nmdc:mga0n895_472346_c1
303 nmdc:mga0n895_62385_c1
304 nmdc:mga0n895_756_c1
305 nmdc:mga0rr50_1077695_c1
306 nmdc:mga0rr50_145388_c1
307 nmdc:mga0rr50_302264_c1
308 nmdc:mga0rr50_73280_c1
309 nmdc:mga08x19_15026_c1
310 nmdc:mga0a205_104701_c1
311 nmdc:mga0a205_18714_c1
312 nmdc:mga0a205_188326_c1
313 nmdc:mga0a205_41_c1
314 nmdc:mga0a205_960372_c1
315 Ga0501082_0699945
316 2888581199
317 2904115722
318 2925330930
319 2980126931

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03819

MazG

MazG nucleotide pyrophosphohydrolase domain

37

116

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gta-assembly1.cif.gz_C crystal structure of the putative pyrophosphatase ypjd from bacillus subtilis. northeast structural genomics consortium target sr428. 0.9487 15 108
5ie9-assembly1.cif.gz_D crystal structure of the bacillus-conserved mazg protein, a nucleotide pyrophosphohydrolase 0.9319 15 109
2gta-assembly1.cif.gz_B crystal structure of the putative pyrophosphatase ypjd from bacillus subtilis. northeast structural genomics consortium target sr428. 0.9202 15 109
2gta-assembly1.cif.gz_C crystal structure of the putative pyrophosphatase ypjd from bacillus subtilis. northeast structural genomics consortium target sr428. 0.917 15 108
5ie9-assembly1.cif.gz_B crystal structure of the bacillus-conserved mazg protein, a nucleotide pyrophosphohydrolase 0.9104 15 109
ID Description Score Start End Superfamily
5ie9D00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9319 15 109 1.10.287.1080
5ie9B00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9104 15 109 1.10.287.1080
5ie9C00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9027 15 109 1.10.287.1080
2gtaB00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.8804 15 109 1.10.287.1080
5ie9D00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.8633 15 109 1.10.287.1080
ID Description Score Start End GO Terms
AF-A0A6C0G1Y6-F1-model_v4 Nucleotide pyrophosphohydrolase 0.9878 15 117 GO:0016787
AF-A0A1H8F456-F1-model_v4 NTP pyrophosphatase, house-cleaning of non-canonical NTPs 0.9862 15 116
AF-A0A6B0CUI2-F1-model_v4 Nucleotide pyrophosphohydrolase 0.9842 15 102 GO:0016787
AF-A0A7C6KUT5-F1-model_v4 Nucleotide pyrophosphohydrolase 0.9841 16 102 GO:0016787
AF-A0A4R2R799-F1-model_v4 NTP pyrophosphatase (Non-canonical NTP hydrolase) 0.9822 15 118 GO:0016787

Map