F230181

General Info

Members Datasets Scaffolds Average Seq Length
158 134 316 132

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_1525920|Ga0395898_1525920_71_460
Length 129
Sequence MDIKRAGSQPSGKGPAEWFTGNVRIDPLFQAPDPALVQGASVTFEPGARTAWHTHPLGQIVTAGCGWAQRNGGPIEEIRSGDVVWFAPGEKHWHGATPTTAMTHIAIQENLNGRVVEWMEQVSDEQYRL

Samples

Sample ID Description Type Environment
1 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
38 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
40 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
41 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
42 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
71 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
73 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
74 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
75 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
78 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
82 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
83 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
84 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
85 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
86 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
87 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
88 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
89 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
90 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
91 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
92 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
93 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
94 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
95 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
96 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
97 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
98 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
99 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
100 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
101 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
102 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
103 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
104 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
105 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
106 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
107 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
115 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
116 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
117 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
118 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
119 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
120 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
121 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
122 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
123 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
124 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
125 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
126 2718217882 Rhizobium sp. N741 Isolate Nodule
127 2718218009 Rhizobium sp. N561 Isolate Nodule
128 2718218363 Rhizobium sp. N113 Isolate Nodule
129 2718218365 Rhizobium sp. N731 Isolate Nodule
130 2718218366 Rhizobium sp. N621 Isolate Nodule
131 2721755514 Rhizobium sp. N6212 Isolate Nodule
132 2721755810 Rhizobium sp. N871 Isolate Nodule
133 2728369365 Rhizobium sp. N1341 Isolate Nodule
134 2728369397 Rhizobium sp. N1314 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.67
Metatranscriptomes 0.63
Isolates 5.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.53
Nodule 5.7
Rhizoplane 1.9
Rhizosphere 86.71
Stem 0
Stem Tuber 0
Unclassified 2.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395898_1525920 3300037466 Bacteria 594
2 Ga0070683_100786250 3300005329 Bacteria 912
3 Ga0070683_100897554 3300005329 Bacteria 850
4 Ga0070683_101168649 3300005329 Unclassified 739
5 Ga0070690_100875418 3300005330 Bacteria 701
6 Ga0070670_100340631 3300005331 Bacteria 1316
7 Ga0070670_100968471 3300005331 Bacteria 773
8 Ga0070682_100284220 3300005337 Bacteria 1207
9 Ga0070687_100520668 3300005343 Bacteria 804
10 Ga0070675_100213900 3300005354 Bacteria 1677
11 Ga0070671_100047274 3300005355 Bacteria 3579
12 Ga0070671_100823950 3300005355 Bacteria 809
13 Ga0070673_100358998 3300005364 Bacteria 1295
14 Ga0070673_100590171 3300005364 Bacteria 1012
15 Ga0070659_100618834 3300005366 Bacteria 932
16 Ga0070667_100737809 3300005367 Bacteria 912
17 Ga0070709_11479377 3300005434 Bacteria 551
18 Ga0070714_100091323 3300005435 Bacteria 2668
19 Ga0070714_100176972 3300005435 Bacteria 1939
20 Ga0070678_100406739 3300005456 Bacteria 1183
21 Ga0070662_100035248 3300005457 Bacteria 3533
22 Ga0070684_101739802 3300005535 Unclassified 588
23 Ga0068853_100125030 3300005539 Bacteria 2297
24 Ga0070672_100032450 3300005543 Bacteria 3941
25 Ga0070672_100101377 3300005543 Bacteria 2336
26 Ga0070686_100684696 3300005544 Bacteria 816
27 Ga0070693_100250719 3300005547 Bacteria 1173
28 Ga0068855_100003897 3300005563 Bacteria 18220
29 Ga0068855_100021257 3300005563 Bacteria 7779
30 Ga0068857_101078093 3300005577 Bacteria 775
31 Ga0068852_100862150 3300005616 Bacteria 921
32 Ga0075432_10294215 3300006058 Bacteria 672
33 Ga0070712_100331951 3300006175 Bacteria 1239
34 Ga0097621_100323155 3300006237 Bacteria 1367
35 Ga0068865_100609381 3300006881 Bacteria 924
36 Ga0105240_10000373 3300009093 Bacteria 84033
37 Ga0105240_10000823 3300009093 Bacteria 56298
38 Ga0105240_10049484 3300009093 Bacteria 5304
39 Ga0111539_10030821 3300009094 Bacteria 6519
40 Ga0105243_10815108 3300009148 Bacteria 921
41 Ga0105241_11773136 3300009174 Bacteria 602
42 Ga0105242_10083337 3300009176 Bacteria 2677
43 Ga0157370_10445711 3300013104 Bacteria 1190
44 Ga0157369_10496517 3300013105 Bacteria 1263
45 Ga0157369_11605705 3300013105 Bacteria 661
46 Ga0157378_10007140 3300013297 Bacteria 9756
47 Ga0157372_10138581 3300013307 Bacteria 2802
48 Ga0157376_11417499 3300014969 Bacteria 726
49 Ga0206349_1612342 3300020075 Bacteria 501
50 Ga0213872_10013070 3300021361 Bacteria 3892
51 Ga0213872_10286296 3300021361 Bacteria 687
52 Ga0213874_10048502 3300021377 Bacteria 1295
53 Ga0213875_10000010 3300021388 Bacteria 370268
54 Ga0207697_10281869 3300025315 Bacteria 736
55 Ga0207656_10121266 3300025321 Bacteria 1217
56 Ga0207699_11305587 3300025906 Bacteria 537
57 Ga0207705_10108045 3300025909 Bacteria 2053
58 Ga0207654_10555363 3300025911 Unclassified 816
59 Ga0207695_10000095 3300025913 Bacteria 265435
60 Ga0207695_10000231 3300025913 Bacteria 148736
61 Ga0207693_10303775 3300025915 Bacteria 1250
62 Ga0207694_10091598 3300025924 Bacteria 2399
63 Ga0207650_10295887 3300025925 Bacteria 1321
64 Ga0207664_10012822 3300025929 Bacteria 6003
65 Ga0207664_10065886 3300025929 Bacteria 2901
66 Ga0207644_11220355 3300025931 Bacteria 632
67 Ga0207690_10638282 3300025932 Bacteria 872
68 Ga0207686_10125391 3300025934 Bacteria 1754
69 Ga0207691_10013204 3300025940 Bacteria 7909
70 Ga0207691_10064931 3300025940 Bacteria 3306
71 Ga0207661_10793466 3300025944 Bacteria 872
72 Ga0207667_10020709 3300025949 Bacteria 7308
73 Ga0207667_10112444 3300025949 Bacteria 2808
74 Ga0207667_11221896 3300025949 Bacteria 730
75 Ga0207651_10157164 3300025960 Bacteria 1778
76 Ga0207712_10596820 3300025961 Bacteria 955
77 Ga0207640_11305885 3300025981 Bacteria 648
78 Ga0207658_10189097 3300025986 Bacteria 1710
79 Ga0207639_10108801 3300026041 Bacteria 2254
80 Ga0207702_10064726 3300026078 Unclassified 3129
81 Ga0207641_11095408 3300026088 Bacteria 795
82 Ga0207648_10697262 3300026089 Bacteria 941
83 Ga0207675_102129680 3300026118 Bacteria 577
84 Ga0207683_10033269 3300026121 Bacteria 4478
85 Ga0207683_10119309 3300026121 Bacteria 2367
86 Ga0207698_11223018 3300026142 Bacteria 765
87 Ga0207698_12558385 3300026142 Bacteria 520
88 Ga0209588_1030445 3300027671 Bacteria 1724
89 Ga0207428_10133093 3300027907 Bacteria 1902
90 Ga0268265_11427268 3300028380 Bacteria 695
91 Ga0265338_10000072 3300028800 Bacteria 182263
92 Ga0265329_10033389 3300031242 Bacteria 1664
93 Ga0265331_10020276 3300031250 Bacteria 3417
94 Ga0265316_10315670 3300031344 Bacteria 1136
95 Ga0265316_10559120 3300031344 Bacteria 814
96 Ga0307416_101084118 3300032002 Bacteria 905
97 Ga0307510_10308296 3300033180 Bacteria 1043
98 Ga0373925_0264273 3300037068 Bacteria 1383
99 Ga0395900_0681214 3300037418 Bacteria 963
100 Ga0395898_0000502 3300037466 Bacteria 76068
101 Ga0395898_0586119 3300037466 Bacteria 1058
102 Ga0395905_0436999 3300037471 Bacteria 1206
103 Ga0436364_0549405 3300037853 Bacteria 734
104 Ga0436361_0752896 3300039447 Bacteria 18068
105 Ga0436361_0878585 3300039447 Bacteria 4119
106 Ga0436363_0931299 3300039450 Bacteria 2714
107 Ga0466967_0192085 3300045976 Bacteria 1930
108 Ga0466967_1413180 3300045976 Bacteria 693
109 Ga0495653_0059382 3300046463 Bacteria 2903
110 Ga0495582_0427369 3300046473 Bacteria 764
111 Ga0495608_0078966 3300046511 Bacteria 2140
112 Ga0495628_0629572 3300046516 Bacteria 764
113 Ga0495630_0018600 3300046517 Bacteria 5106
114 Ga0495631_0193719 3300046518 Bacteria 870
115 Ga0495643_0029592 3300046522 Bacteria 3063
116 Ga0495644_0054685 3300046523 Bacteria 1499
117 Ga0495666_0142558 3300046526 Bacteria 1116
118 Ga0495665_0179666 3300046531 Bacteria 1100
119 Ga0495609_0005912 3300046538 Bacteria 6323
120 Ga0495645_0922947 3300046543 Bacteria 517
121 Ga0495622_0349721 3300046557 Bacteria 640
122 Ga0495611_0042295 3300046648 Bacteria 2034
123 Ga0495599_0231246 3300046678 Bacteria 1129
124 Ga0495624_0045288 3300046690 Bacteria 2802
125 Ga0495581_0016189 3300047315 Bacteria 4335
126 Ga0495674_0036750 3300047319 Bacteria 4406
127 Ga0495614_0349850 3300048089 Bacteria 689
128 Ga0496111_1124678 3300048914 Bacteria 559
129 Ga0496114_0900495 3300048917 Bacteria 766
130 Ga0496115_0417319 3300048918 Bacteria 1087
131 Ga0501032_0195544 3300049569 Bacteria 1321
132 Ga0501033_0029175 3300049570 Bacteria 4146
133 Ga0501034_0056897 3300049571 Bacteria 3933
134 Ga0501036_0446349 3300049572 Bacteria 1078
135 Ga0501037_0012645 3300049573 Bacteria 6220
136 Ga0501043_0062904 3300049579 Bacteria 2914
137 Ga0501047_0509733 3300049581 Bacteria 1029
138 Ga0501073_0010686 3300049589 Bacteria 6723
139 Ga0501080_0041261 3300049742 Bacteria 4301
140 Ga0501083_0158811 3300049744 Bacteria 1479
141 Ga0501045_1158683 3300049824 Bacteria 565
142 Ga0495601_0425319 3300053077 Bacteria 860
143 Ga0495612_0031302 3300053078 Bacteria 2145
144 Ga0500595_014967 3300053119 Bacteria 2927
145 Ga0500628_001644 3300053129 Bacteria 3789
146 Ga0500568_0006621 3300053139 Bacteria 5795
147 Ga0500616_0001356 3300053153 Bacteria 23862
148 Ga0501084_1292685 3300054114 Bacteria 611
149 Ga0501082_0019076 3300060353 Bacteria 5910
150 2719181252 2718217882 Bacteria 6556348
151 2719732001 2718218009 Bacteria 6478651
152 2721147346 2718218363 Bacteria 6524337
153 2721158880 2718218365 Bacteria 6274507
154 2721164264 2718218366 Bacteria 6425255
155 2722840434 2721755514 Bacteria 6424414
156 2724044757 2721755810 Bacteria 6479005
157 2730164489 2728369365 Bacteria 6555560
158 2730298512 2728369397 Bacteria 6274511
159 Ga0395898_1525920
160 Ga0070683_100786250
161 Ga0070683_100897554
162 Ga0070683_101168649
163 Ga0070690_100875418
164 Ga0070670_100340631
165 Ga0070670_100968471
166 Ga0070682_100284220
167 Ga0070687_100520668
168 Ga0070675_100213900
169 Ga0070671_100047274
170 Ga0070671_100823950
171 Ga0070673_100358998
172 Ga0070673_100590171
173 Ga0070659_100618834
174 Ga0070667_100737809
175 Ga0070709_11479377
176 Ga0070714_100091323
177 Ga0070714_100176972
178 Ga0070678_100406739
179 Ga0070662_100035248
180 Ga0070684_101739802
181 Ga0068853_100125030
182 Ga0070672_100032450
183 Ga0070672_100101377
184 Ga0070686_100684696
185 Ga0070693_100250719
186 Ga0068855_100003897
187 Ga0068855_100021257
188 Ga0068857_101078093
189 Ga0068852_100862150
190 Ga0075432_10294215
191 Ga0070712_100331951
192 Ga0097621_100323155
193 Ga0068865_100609381
194 Ga0105240_10000373
195 Ga0105240_10000823
196 Ga0105240_10049484
197 Ga0111539_10030821
198 Ga0105243_10815108
199 Ga0105241_11773136
200 Ga0105242_10083337
201 Ga0157370_10445711
202 Ga0157369_10496517
203 Ga0157369_11605705
204 Ga0157378_10007140
205 Ga0157372_10138581
206 Ga0157376_11417499
207 Ga0206349_1612342
208 Ga0213872_10013070
209 Ga0213872_10286296
210 Ga0213874_10048502
211 Ga0213875_10000010
212 Ga0207697_10281869
213 Ga0207656_10121266
214 Ga0207699_11305587
215 Ga0207705_10108045
216 Ga0207654_10555363
217 Ga0207695_10000095
218 Ga0207695_10000231
219 Ga0207693_10303775
220 Ga0207694_10091598
221 Ga0207650_10295887
222 Ga0207664_10012822
223 Ga0207664_10065886
224 Ga0207644_11220355
225 Ga0207690_10638282
226 Ga0207686_10125391
227 Ga0207691_10013204
228 Ga0207691_10064931
229 Ga0207661_10793466
230 Ga0207667_10020709
231 Ga0207667_10112444
232 Ga0207667_11221896
233 Ga0207651_10157164
234 Ga0207712_10596820
235 Ga0207640_11305885
236 Ga0207658_10189097
237 Ga0207639_10108801
238 Ga0207702_10064726
239 Ga0207641_11095408
240 Ga0207648_10697262
241 Ga0207675_102129680
242 Ga0207683_10033269
243 Ga0207683_10119309
244 Ga0207698_11223018
245 Ga0207698_12558385
246 Ga0209588_1030445
247 Ga0207428_10133093
248 Ga0268265_11427268
249 Ga0265338_10000072
250 Ga0265329_10033389
251 Ga0265331_10020276
252 Ga0265316_10315670
253 Ga0265316_10559120
254 Ga0307416_101084118
255 Ga0307510_10308296
256 Ga0373925_0264273
257 Ga0395900_0681214
258 Ga0395898_0000502
259 Ga0395898_0586119
260 Ga0395905_0436999
261 Ga0436364_0549405
262 Ga0436361_0752896
263 Ga0436361_0878585
264 Ga0436363_0931299
265 Ga0466967_0192085
266 Ga0466967_1413180
267 Ga0495653_0059382
268 Ga0495582_0427369
269 Ga0495608_0078966
270 Ga0495628_0629572
271 Ga0495630_0018600
272 Ga0495631_0193719
273 Ga0495643_0029592
274 Ga0495644_0054685
275 Ga0495666_0142558
276 Ga0495665_0179666
277 Ga0495609_0005912
278 Ga0495645_0922947
279 Ga0495622_0349721
280 Ga0495611_0042295
281 Ga0495599_0231246
282 Ga0495624_0045288
283 Ga0495581_0016189
284 Ga0495674_0036750
285 Ga0495614_0349850
286 Ga0496111_1124678
287 Ga0496114_0900495
288 Ga0496115_0417319
289 Ga0501032_0195544
290 Ga0501033_0029175
291 Ga0501034_0056897
292 Ga0501036_0446349
293 Ga0501037_0012645
294 Ga0501043_0062904
295 Ga0501047_0509733
296 Ga0501073_0010686
297 Ga0501080_0041261
298 Ga0501083_0158811
299 Ga0501045_1158683
300 Ga0495601_0425319
301 Ga0495612_0031302
302 Ga0500595_014967
303 Ga0500628_001644
304 Ga0500568_0006621
305 Ga0500616_0001356
306 Ga0501084_1292685
307 Ga0501082_0019076
308 2719181252
309 2719732001
310 2721147346
311 2721158880
312 2721164264
313 2722840434
314 2724044757
315 2730164489
316 2730298512

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4uxa-assembly3.cif.gz_R improved variant of (r)-selective manganese-dependent hydroxynitrile lyase from bacteria 0.9596 1 131
4bif-assembly2.cif.gz_H biochemical and structural characterisation of a novel manganese- dependent hydroxynitrile lyase from bacteria 0.9574 1 131
2ozj-assembly2.cif.gz_B-3 crystal structure of a cupin superfamily protein (dsy2733) from desulfitobacterium hafniense dcb-2 at 1.60 a resolution 0.9277 23 111
3rns-assembly1.cif.gz_A cupin 2 conserved barrel domain protein from leptotrichia buccalis 0.8934 21 112
2f4p-assembly2.cif.gz_C crystal structure of a cupin-like protein (tm1010) from thermotoga maritima msb8 at 1.90 a resolution 0.8889 1 130
ID Description Score Start End Superfamily
4bifA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9574 1 131 2.60.120.10
2f4pA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9379 12 130 2.60.120.10
2ozjB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9004 23 111 2.60.120.10
3cewA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.889 35 112 2.60.120.10
af_A0A1D6GLE7_2_119_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8885 52 106 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A659YKM7-F1-model_v4 deleted 1 41 126
AF-A0A0T7FD29-F1-model_v4 Cupin type-2 domain-containing protein 0.9981 43 130
AF-A0A4Q6DG11-F1-model_v4 deleted 0.9966 37 130
AF-A0A4Q3QCU4-F1-model_v4 deleted 0.9955 37 130
AF-F3KPW6-F1-model_v4 Cupin 2 barrel domain-containing protein 0.9947 39 129

Map