F230116

General Info

Members Datasets Scaffolds Average Seq Length
158 97 316 273

Family's Representative Sequence

Representative Sequence 3300035118|Ga0373954_0019232|Ga0373954_0019232_92_1069
Length 325
Sequence LFAFAQLSQGSSFLATLGFKPESLWDSDLQFQSILKIGLRSLAHLRLCASALIHFILMPQSTRANPIASAIGRIPYRLQLAGGWIDQPFVSRRNPKPPGSMVVVAVEPTFHFMDRAGCATGTRKIAMKLWNGRLPKGDPAKLVRELYAAENRGKAEPSGSQDMIGIVYPGINRLDYDFAANGGVFPSHIESLNRPRIARWLERVLHVLTIEPRPDGYSPLGQKNLDPNWIARLGRTGQDCFDAIRRMDVNALGTSLNDCMRCWETILPHVVKHSSLKLDLLAILRAYQAEYPGAMYSGCGGGYLFVASDDPVPGAFHVNIRTQAR

Samples

Sample ID Description Type Environment
1 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
4 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
5 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
6 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
7 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
8 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
9 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
10 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
11 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
12 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
13 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
14 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
15 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
16 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
17 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
18 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
19 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
20 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
21 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
22 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
23 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
35 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
36 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
37 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
38 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
39 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
40 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
41 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
42 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
43 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
44 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
45 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
46 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
47 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
48 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
49 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
50 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
51 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
52 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
53 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
54 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
55 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
56 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
57 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
58 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
59 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
60 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
61 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
62 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
63 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
64 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
65 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
66 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
67 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
68 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
69 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
70 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
71 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
72 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
73 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
74 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
75 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
76 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
77 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
78 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
79 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
80 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
81 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
82 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
83 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
84 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
85 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
86 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
87 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
88 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
89 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
94 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
95 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
97 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.37
Metatranscriptomes 0.63
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 98.73
Stem 0
Stem Tuber 0
Unclassified 17.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373954_0019232 3300035118 Bacteria 3079
2 rootH2_10010433 3300003320 Bacteria 15628
3 Ga0070711_100021533 3300005439 Unclassified 4171
4 Ga0068867_100070441 3300005459 Bacteria 2614
5 Ga0070685_10210958 3300005466 Bacteria 1267
6 Ga0070684_100008425 3300005535 Bacteria 8058
7 Ga0068853_100330559 3300005539 Bacteria 1414
8 Ga0068855_100041835 3300005563 Bacteria 5430
9 Ga0068856_100000760 3300005614 Bacteria 34998
10 Ga0068859_100045987 3300005617 Bacteria 4384
11 Ga0068864_100195358 3300005618 Unclassified 1856
12 Ga0068858_100168862 3300005842 Unclassified 2062
13 Ga0097620_100045987 3300006931 Bacteria 4384
14 Ga0105240_10090145 3300009093 Unclassified 3749
15 Ga0105240_10321310 3300009093 Bacteria 1764
16 Ga0105242_10091544 3300009176 Unclassified 2560
17 Ga0105237_10014187 3300009545 Bacteria 8343
18 Ga0105237_10321130 3300009545 Bacteria 1552
19 Ga0105238_10004756 3300009551 Bacteria 13433
20 Ga0105239_10058101 3300010375 Bacteria 4244
21 Ga0105246_10243626 3300011119 Bacteria 1423
22 Ga0157369_10086034 3300013105 Bacteria 3358
23 Ga0157374_10054710 3300013296 Bacteria 3723
24 Ga0163162_10557979 3300013306 Unclassified 1273
25 Ga0207654_10143760 3300025911 Bacteria 1524
26 Ga0207671_10037342 3300025914 Bacteria 3602
27 Ga0207663_10089245 3300025916 Bacteria 2041
28 Ga0207694_10055776 3300025924 Bacteria 3067
29 Ga0207687_10108710 3300025927 Bacteria 2054
30 Ga0207687_10192426 3300025927 Unclassified 1589
31 Ga0207686_10068102 3300025934 Unclassified 2279
32 Ga0207689_10071953 3300025942 Unclassified 2840
33 Ga0207667_10288202 3300025949 Bacteria 1678
34 Ga0207702_10000506 3300026078 Bacteria 43980
35 Ga0207648_10072021 3300026089 Bacteria 3012
36 Ga0207675_100486355 3300026118 Bacteria 1227
37 Ga0265337_1000257 3300028556 Bacteria 28698
38 Ga0265337_1007053 3300028556 Bacteria 4247
39 Ga0265337_1042989 3300028556 Bacteria 1293
40 Ga0265326_10006605 3300028558 Unclassified 3593
41 Ga0265326_10037942 3300028558 Bacteria 1369
42 Ga0265319_1000019 3300028563 Bacteria 154537
43 Ga0265318_10049169 3300028577 Bacteria 1587
44 Ga0265323_10000489 3300028653 Bacteria 22332
45 Ga0265323_10001533 3300028653 Bacteria 11215
46 Ga0265323_10004584 3300028653 Bacteria 5945
47 Ga0265323_10040111 3300028653 Bacteria 1704
48 Ga0265323_10044502 3300028653 Bacteria 1598
49 Ga0265323_10047650 3300028653 Bacteria 1532
50 Ga0265323_10049414 3300028653 Bacteria 1497
51 Ga0265322_10000892 3300028654 Bacteria 10580
52 Ga0265322_10003236 3300028654 Bacteria 4942
53 Ga0265336_10039976 3300028666 Unclassified 1436
54 Ga0265338_10001055 3300028800 Bacteria 45944
55 Ga0265338_10023411 3300028800 Bacteria 6352
56 Ga0265338_10032856 3300028800 Bacteria 5050
57 Ga0265338_10048252 3300028800 Bacteria 3876
58 Ga0265338_10120611 3300028800 Bacteria 2091
59 Ga0265324_10008796 3300029957 Bacteria 3981
60 Ga0265324_10012120 3300029957 Bacteria 3263
61 Ga0265324_10045445 3300029957 Bacteria 1512
62 Ga0265330_10007168 3300031235 Bacteria 5461
63 Ga0265330_10015908 3300031235 Unclassified 3476
64 Ga0265330_10160289 3300031235 Bacteria 955
65 Ga0265332_10012281 3300031238 Bacteria 3799
66 Ga0265332_10016306 3300031238 Unclassified 3278
67 Ga0265332_10033262 3300031238 Bacteria 2245
68 Ga0265328_10003715 3300031239 Bacteria 6727
69 Ga0265328_10111706 3300031239 Unclassified 1016
70 Ga0265320_10052053 3300031240 Bacteria 1984
71 Ga0265320_10053356 3300031240 Unclassified 1955
72 Ga0265325_10002074 3300031241 Bacteria 13718
73 Ga0265325_10017548 3300031241 Bacteria 3977
74 Ga0265329_10004386 3300031242 Bacteria 5884
75 Ga0265329_10004933 3300031242 Bacteria 5461
76 Ga0265339_10011945 3300031249 Bacteria 5322
77 Ga0265339_10038343 3300031249 Unclassified 2674
78 Ga0265339_10103372 3300031249 Unclassified 1480
79 Ga0265316_10000109 3300031344 Bacteria 88245
80 Ga0265316_10003398 3300031344 Bacteria 16107
81 Ga0265316_10008525 3300031344 Bacteria 9503
82 Ga0265316_10013475 3300031344 Bacteria 7259
83 Ga0265316_10016327 3300031344 Bacteria 6444
84 Ga0265316_10020064 3300031344 Bacteria 5698
85 Ga0265316_10027606 3300031344 Bacteria 4696
86 Ga0265316_10381152 3300031344 Bacteria 1017
87 Ga0265313_10002938 3300031595 Bacteria 14231
88 Ga0316579_10021940 3300031691 Unclassified 2851
89 Ga0265314_10000420 3300031711 Bacteria 57180
90 Ga0265314_10000554 3300031711 Bacteria 47642
91 Ga0265314_10008412 3300031711 Bacteria 8844
92 Ga0265314_10042308 3300031711 Bacteria 3252
93 Ga0265314_10049181 3300031711 Unclassified 2954
94 Ga0265314_10144740 3300031711 Unclassified 1465
95 Ga0265342_10000957 3300031712 Bacteria 28741
96 Ga0265342_10057483 3300031712 Bacteria 2302
97 Ga0265342_10090165 3300031712 Bacteria 1758
98 Ga0265342_10110452 3300031712 Bacteria 1557
99 Ga0265342_10121467 3300031712 Bacteria 1471
100 Ga0265342_10159691 3300031712 Bacteria 1246
101 Ga0316583_10086279 3300032133 Unclassified 1096
102 Ga0316585_10002703 3300032137 Unclassified 4814
103 Ga0316580_10038879 3300032139 Unclassified 1470
104 Ga0316593_10030735 3300032168 Bacteria 1746
105 Ga0373929_0000250 3300035085 Bacteria 9928
106 Ga0373944_0001761 3300035089 Bacteria 5469
107 Ga0373949_0000873 3300035090 Bacteria 9519
108 Ga0373932_0000001 3300035112 Bacteria 1459067
109 Ga0373962_0000032 3300035242 Bacteria 35295
110 Ga0373924_0119935 3300035410 Bacteria 1141
111 Ga0373931_0000008 3300035691 Bacteria 362269
112 Ga0373935_0007553 3300035692 Bacteria 6509
113 Ga0373935_0009016 3300035692 Bacteria 5968
114 Ga0373927_0003491 3300035695 Bacteria 11259
115 Ga0373947_0016379 3300035725 Bacteria 4260
116 Ga0373947_0112420 3300035725 Bacteria 1722
117 Ga0373937_0434082 3300036401 Unclassified 1247
118 Ga0316582_0268905 3300036647 Unclassified 1169
119 Ga0316584_0188706 3300036712 Unclassified 1524
120 Ga0373925_0000451 3300037068 Bacteria 41493
121 Ga0373925_0001089 3300037068 Bacteria 24361
122 Ga0373925_0023775 3300037068 Bacteria 4470
123 Ga0316581_0050360 3300037588 Unclassified 1276
124 Ga0400489_25541 3300039093 Bacteria 1407
125 Ga0451577_0083409 3300042876 Bacteria 2851
126 Ga0451577_0100925 3300042876 Bacteria 2578
127 Ga0453684_0004964 3300044712 Bacteria 27076
128 Ga0453684_0405618 3300044712 Unclassified 1525
129 Ga0451576_0015290 3300045051 Bacteria 8508
130 Ga0451576_0094402 3300045051 Bacteria 3111
131 Ga0451576_0370466 3300045051 Bacteria 1501
132 Ga0495641_0029868 3300046461 Bacteria 2621
133 Ga0495630_0017079 3300046517 Bacteria 5311
134 Ga0495630_0287603 3300046517 Bacteria 1256
135 Ga0495640_0079621 3300046533 Bacteria 2181
136 Ga0495586_0000012 3300046535 Bacteria 138093
137 Ga0495586_0037862 3300046535 Bacteria 2589
138 Ga0495645_0100976 3300046543 Bacteria 2051
139 Ga0495634_0010721 3300046642 Bacteria 6708
140 Ga0495634_0012884 3300046642 Bacteria 6053
141 Ga0495599_0191585 3300046678 Bacteria 1258
142 Ga0495658_0006537 3300046683 Bacteria 5726
143 Ga0495613_0075866 3300046689 Bacteria 2447
144 Ga0495674_0000442 3300047319 Bacteria 37312
145 Ga0495674_0125580 3300047319 Bacteria 2165
146 Ga0495676_0003605 3300047321 Bacteria 14053
147 Ga0495676_0063747 3300047321 Bacteria 2871
148 Ga0501033_0048915 3300049570 Bacteria 3140
149 Ga0501033_0219688 3300049570 Bacteria 1353
150 Ga0501037_0205185 3300049573 Bacteria 1392
151 Ga0501043_0063877 3300049579 Bacteria 2891
152 Ga0501047_0276304 3300049581 Bacteria 1525
153 Ga0501070_0183327 3300049586 Bacteria 1722
154 Ga0501080_0050110 3300049742 Bacteria 3887
155 Ga0501035_0047879 3300049822 Bacteria 3836
156 Ga0501044_0000288 3300049823 Bacteria 64311
157 Ga0501044_0093460 3300049823 Bacteria 3032
158 Ga0501082_0184793 3300060353 Bacteria 1814
159 Ga0373954_0019232
160 rootH2_10010433
161 Ga0070711_100021533
162 Ga0068867_100070441
163 Ga0070685_10210958
164 Ga0070684_100008425
165 Ga0068853_100330559
166 Ga0068855_100041835
167 Ga0068856_100000760
168 Ga0068859_100045987
169 Ga0068864_100195358
170 Ga0068858_100168862
171 Ga0097620_100045987
172 Ga0105240_10090145
173 Ga0105240_10321310
174 Ga0105242_10091544
175 Ga0105237_10014187
176 Ga0105237_10321130
177 Ga0105238_10004756
178 Ga0105239_10058101
179 Ga0105246_10243626
180 Ga0157369_10086034
181 Ga0157374_10054710
182 Ga0163162_10557979
183 Ga0207654_10143760
184 Ga0207671_10037342
185 Ga0207663_10089245
186 Ga0207694_10055776
187 Ga0207687_10108710
188 Ga0207687_10192426
189 Ga0207686_10068102
190 Ga0207689_10071953
191 Ga0207667_10288202
192 Ga0207702_10000506
193 Ga0207648_10072021
194 Ga0207675_100486355
195 Ga0265337_1000257
196 Ga0265337_1007053
197 Ga0265337_1042989
198 Ga0265326_10006605
199 Ga0265326_10037942
200 Ga0265319_1000019
201 Ga0265318_10049169
202 Ga0265323_10000489
203 Ga0265323_10001533
204 Ga0265323_10004584
205 Ga0265323_10040111
206 Ga0265323_10044502
207 Ga0265323_10047650
208 Ga0265323_10049414
209 Ga0265322_10000892
210 Ga0265322_10003236
211 Ga0265336_10039976
212 Ga0265338_10001055
213 Ga0265338_10023411
214 Ga0265338_10032856
215 Ga0265338_10048252
216 Ga0265338_10120611
217 Ga0265324_10008796
218 Ga0265324_10012120
219 Ga0265324_10045445
220 Ga0265330_10007168
221 Ga0265330_10015908
222 Ga0265330_10160289
223 Ga0265332_10012281
224 Ga0265332_10016306
225 Ga0265332_10033262
226 Ga0265328_10003715
227 Ga0265328_10111706
228 Ga0265320_10052053
229 Ga0265320_10053356
230 Ga0265325_10002074
231 Ga0265325_10017548
232 Ga0265329_10004386
233 Ga0265329_10004933
234 Ga0265339_10011945
235 Ga0265339_10038343
236 Ga0265339_10103372
237 Ga0265316_10000109
238 Ga0265316_10003398
239 Ga0265316_10008525
240 Ga0265316_10013475
241 Ga0265316_10016327
242 Ga0265316_10020064
243 Ga0265316_10027606
244 Ga0265316_10381152
245 Ga0265313_10002938
246 Ga0316579_10021940
247 Ga0265314_10000420
248 Ga0265314_10000554
249 Ga0265314_10008412
250 Ga0265314_10042308
251 Ga0265314_10049181
252 Ga0265314_10144740
253 Ga0265342_10000957
254 Ga0265342_10057483
255 Ga0265342_10090165
256 Ga0265342_10110452
257 Ga0265342_10121467
258 Ga0265342_10159691
259 Ga0316583_10086279
260 Ga0316585_10002703
261 Ga0316580_10038879
262 Ga0316593_10030735
263 Ga0373929_0000250
264 Ga0373944_0001761
265 Ga0373949_0000873
266 Ga0373932_0000001
267 Ga0373962_0000032
268 Ga0373924_0119935
269 Ga0373931_0000008
270 Ga0373935_0007553
271 Ga0373935_0009016
272 Ga0373927_0003491
273 Ga0373947_0016379
274 Ga0373947_0112420
275 Ga0373937_0434082
276 Ga0316582_0268905
277 Ga0316584_0188706
278 Ga0373925_0000451
279 Ga0373925_0001089
280 Ga0373925_0023775
281 Ga0316581_0050360
282 Ga0400489_25541
283 Ga0451577_0083409
284 Ga0451577_0100925
285 Ga0453684_0004964
286 Ga0453684_0405618
287 Ga0451576_0015290
288 Ga0451576_0094402
289 Ga0451576_0370466
290 Ga0495641_0029868
291 Ga0495630_0017079
292 Ga0495630_0287603
293 Ga0495640_0079621
294 Ga0495586_0000012
295 Ga0495586_0037862
296 Ga0495645_0100976
297 Ga0495634_0010721
298 Ga0495634_0012884
299 Ga0495599_0191585
300 Ga0495658_0006537
301 Ga0495613_0075866
302 Ga0495674_0000442
303 Ga0495674_0125580
304 Ga0495676_0003605
305 Ga0495676_0063747
306 Ga0501033_0048915
307 Ga0501033_0219688
308 Ga0501037_0205185
309 Ga0501043_0063877
310 Ga0501047_0276304
311 Ga0501070_0183327
312 Ga0501080_0050110
313 Ga0501035_0047879
314 Ga0501044_0000288
315 Ga0501044_0093460
316 Ga0501082_0184793

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rur-assembly1.cif.gz_N structure of the scin stabilized c3bbb convertase bound to properdin 0.7056 158 203
4usm-assembly1.cif.gz_B wcbl complex with glycerol bound to sugar site 0.6505 12 263
4usk-assembly1.cif.gz_B unravelling the b. pseudomallei heptokinase wcbl: from structure to drug discovery. 0.641 12 263
1s4e-assembly5.cif.gz_E pyrococcus furiosus galactokinase in complex with galactose, adp and magnesium 0.6378 12 262
2dej-assembly1.cif.gz_A crystal structure of galaktokinase from pyrococcus horikoshii with amp-pn and galactose 0.6318 12 260
ID Description Score Start End Superfamily
3t49D00 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; 0.9387 165 203 1.20.1270.10
af_Q9SAC5_34_166_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.9178 166 204 1.20.140.40
4br6B01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.8928 167 201 1.10.287.990
af_I1MG16_39_183_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.8888 166 204 1.20.140.40
af_P41977_43_105_1.10.287.990 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.8464 167 201 1.10.287.990
ID Description Score Start End GO Terms
AF-X1DG97-F1-model_v4 GHMP kinase C-terminal domain-containing protein 0.9897 141 261
AF-A0A1W9LER4-F1-model_v4 GHMP kinase C-terminal domain-containing protein 0.9883 58 260
AF-A0A1F8SZM9-F1-model_v4 GHMP kinase C-terminal domain-containing protein 0.9831 11 262
AF-A0A1F8SZM9-F1-model_v4 GHMP kinase C-terminal domain-containing protein 0.9754 11 262
AF-A0A1W9LER4-F1-model_v4 GHMP kinase C-terminal domain-containing protein 0.974 58 260

Map