F229822

General Info

Members Datasets Scaffolds Average Seq Length
158 105 155 220

Family's Representative Sequence

Representative Sequence 3300025914|Ga0207671_10011083|Ga0207671_100110836
Length 218
Sequence MNFLSHYYFDRDVTNCYHILGTVLPDLLKNADKTIVLHPEKLHHQNEHVNSIIKGWNKHLEVDKYFHSSNFFLTHSHQLKKELAPVIEGSPVKPFFLGHIALELILDNLLITTNNFYEHIQSCDDAIIQEFLTFAGLADSTKFFRFFNGFKKDGYLHTYSETPKIAYALKRICMRVWKDPFTDEHEEAINEVVVVYREHIYDDFMQIFNEIDNKLTPN

Samples

Sample ID Description Type Environment
1 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
2 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
3 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
4 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
35 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
43 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
44 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
45 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
46 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
48 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
49 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
69 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
70 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
71 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
72 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
75 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
76 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
77 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
78 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
79 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
80 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
81 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
82 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
83 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
84 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
85 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
86 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
87 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
88 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
89 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
90 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
91 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
92 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
93 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
94 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
95 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
96 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
97 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
98 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
99 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
100 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
101 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
102 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
103 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
104 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
105 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.47
Metatranscriptomes 0
Isolates 2.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.19
Nodule 0
Rhizoplane 0
Rhizosphere 77.22
Stem 0
Stem Tuber 0
Unclassified 7.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10018922 3300001979 Bacteria 2433
2 JGI24737J22298_10003858 3300001990 Bacteria 5270
3 JGI24735J21928_10005118 3300002067 Bacteria 4366
4 JGI25162J39368_1000059 3300002737 Bacteria 138925
5 JGI25162J39368_1000823 3300002737 Bacteria 20446
6 JGI25162J39368_1000899 3300002737 Bacteria 19364
7 JGI25157J39369_1012460 3300002741 Bacteria 1081
8 JGI25164J39214_1000963 3300002772 Bacteria 9237
9 JGI25165J46597_1000739 3300003214 Bacteria 25461
10 rootH2_10051744 3300003320 Bacteria 1113
11 rootH2_10056133 3300003320 Bacteria 5627
12 rootH1_10029533 3300003323 Bacteria 26337
13 rootH1_10033715 3300003316 Bacteria 5415
14 rootH1_10033715 3300003323 Bacteria 2049
15 rootH1_10202357 3300003323 Bacteria 1340
16 Ga0065714_10176766 3300005288 Bacteria 980
17 Ga0070680_100007736 3300005336 Bacteria 8191
18 Ga0070660_100350836 3300005339 Bacteria 1215
19 Ga0070659_100196982 3300005366 Bacteria 1657
20 Ga0070663_100034329 3300005455 Bacteria 3513
21 Ga0070681_10000745 3300005458 Bacteria 27011
22 Ga0070679_100008263 3300005530 Bacteria 9791
23 Ga0070679_100398035 3300005530 Bacteria 1323
24 Ga0068853_100059873 3300005539 Bacteria 3290
25 Ga0068855_100000342 3300005563 Bacteria 57870
26 Ga0068855_100011192 3300005563 Bacteria 10834
27 Ga0068855_100035707 3300005563 Bacteria 5921
28 Ga0068857_100070048 3300005577 Bacteria 3123
29 Ga0068854_100083955 3300005578 Bacteria 2356
30 Ga0068856_100020764 3300005614 Bacteria 6382
31 Ga0068856_100568071 3300005614 Bacteria 1155
32 Ga0068856_100686420 3300005614 Bacteria 1044
33 Ga0075366_10000801 3300006195 Bacteria 15034
34 Ga0097621_100681060 3300006237 Bacteria 945
35 Ga0105240_10000200 3300009093 Bacteria 121941
36 Ga0105240_10036278 3300009093 Bacteria 6344
37 Ga0105240_10046849 3300009093 Bacteria 5475
38 Ga0105240_10120121 3300009093 Bacteria 3165
39 Ga0105240_10193664 3300009093 Bacteria 2389
40 Ga0105241_10039240 3300009174 Bacteria 3571
41 Ga0105241_10329409 3300009174 Bacteria 1319
42 Ga0105241_10453556 3300009174 Bacteria 1135
43 Ga0105242_10789214 3300009176 Bacteria 939
44 Ga0105237_10000239 3300009545 Bacteria 78319
45 Ga0105237_10007163 3300009545 Bacteria 12252
46 Ga0105238_10450189 3300009551 Bacteria 1284
47 Ga0105239_10000001 3300010375 Bacteria 617353
48 Ga0105239_10000059 3300010375 Bacteria 155685
49 Ga0105239_10001792 3300010375 Bacteria 28226
50 Ga0105239_10003333 3300010375 Bacteria 19771
51 Ga0105239_10052735 3300010375 Bacteria 4460
52 Ga0105239_10266971 3300010375 Bacteria 1924
53 Ga0157373_10013923 3300013100 Bacteria 5899
54 Ga0157371_10000805 3300013102 Bacteria 35999
55 Ga0157371_10000849 3300013102 Bacteria 34894
56 Ga0157370_10011311 3300013104 Bacteria 9351
57 Ga0157370_10045132 3300013104 Bacteria 4230
58 Ga0157369_10000664 3300013105 Bacteria 44521
59 Ga0157374_10117555 3300013296 Bacteria 2563
60 Ga0163162_10000116 3300013306 Bacteria 70911
61 Ga0163162_10007180 3300013306 Bacteria 10816
62 Ga0163162_10693247 3300013306 Bacteria 1140
63 Ga0163162_11002645 3300013306 Bacteria 944
64 Ga0157372_10000109 3300013307 Bacteria 86749
65 Ga0157372_10008123 3300013307 Bacteria 11158
66 Ga0157375_10015825 3300013308 Bacteria 6759
67 Ga0163161_10182617 3300017792 Bacteria 1609
68 Ga0207427_100066 3300025231 Bacteria 165770
69 Ga0209437_100010 3300025233 Bacteria 838447
70 Ga0209437_100169 3300025233 Bacteria 142584
71 Ga0209026_1004175 3300025250 Bacteria 4417
72 Ga0209148_1012091 3300025254 Bacteria 1586
73 Ga0209129_1006486 3300025258 Bacteria 3762
74 Ga0209233_1000017 3300025261 Bacteria 898076
75 Ga0209455_1001199 3300025272 Bacteria 12381
76 Ga0207647_10000128 3300025904 Bacteria 59284
77 Ga0207705_10184959 3300025909 Bacteria 1574
78 Ga0207654_10018195 3300025911 Bacteria 3684
79 Ga0207707_10024568 3300025912 Bacteria 5274
80 Ga0207695_10000055 3300025913 Bacteria 382776
81 Ga0207695_10040951 3300025913 Bacteria 4961
82 Ga0207695_10061361 3300025913 Bacteria 3885
83 Ga0207695_10188241 3300025913 Bacteria 1982
84 Ga0207671_10002729 3300025914 Bacteria 18463
85 Ga0207671_10011083 3300025914 Bacteria 7374
86 Ga0207671_10048644 3300025914 Bacteria 3138
87 Ga0207660_10027265 3300025917 Bacteria 3896
88 Ga0207652_10219522 3300025921 Bacteria 1713
89 Ga0207644_10014566 3300025931 Bacteria 5263
90 Ga0207690_10141639 3300025932 Bacteria 1772
91 Ga0207669_10354814 3300025937 Bacteria 1134
92 Ga0207667_10000015 3300025949 Bacteria 417534
93 Ga0207667_10003651 3300025949 Bacteria 18976
94 Ga0207667_10007607 3300025949 Bacteria 12985
95 Ga0207667_10310349 3300025949 Bacteria 1611
96 Ga0207667_10433981 3300025949 Bacteria 1336
97 Ga0207640_10039754 3300025981 Bacteria 2980
98 Ga0207639_10018597 3300026041 Bacteria 4941
99 Ga0207678_10116228 3300026067 Bacteria 2282
100 Ga0207702_10055367 3300026078 Bacteria 3363
101 Ga0207702_10555569 3300026078 Bacteria 1123
102 Ga0207674_10257281 3300026116 Bacteria 1693
103 Ga0268266_10000111 3300028379 Bacteria 169743
104 Ga0307515_10001027 3300028794 Bacteria 63746
105 Ga0307515_10002940 3300028794 Bacteria 36133
106 Ga0265338_10336679 3300028800 Bacteria 1088
107 Ga0307513_10620149 3300031456 Bacteria 790
108 Ga0307507_10000036 3300033179 Bacteria 187512
109 Ga0395899_0000001 3300037312 Bacteria 1750322
110 Ga0395899_0003279 3300037312 Bacteria 12831
111 Ga0395900_0000095 3300037418 Bacteria 164383
112 Ga0395900_0000370 3300037418 Bacteria 64745
113 Ga0395900_0085062 3300037418 Bacteria 3251
114 Ga0395898_0051852 3300037466 Bacteria 4010
115 Ga0395905_0000529 3300037471 Bacteria 52320
116 Ga0395901_0000580 3300038443 Bacteria 42442
117 Ga0436361_0269064 3300039447 Bacteria 23413
118 Ga0439448_0017709 3300042005 Bacteria 2177
119 Ga0466969_0057262 3300044656 Bacteria 1900
120 Ga0466958_0039001 3300045836 Bacteria 2852
121 Ga0495651_0144139 3300046462 Bacteria 1724
122 Ga0495585_0000947 3300046492 Bacteria 24468
123 Ga0495606_0000035 3300046507 Bacteria 243820
124 Ga0495606_0045984 3300046507 Bacteria 2888
125 Ga0495606_0076076 3300046507 Bacteria 2099
126 Ga0495616_0029122 3300046513 Bacteria 2918
127 Ga0495631_0182761 3300046518 Bacteria 898
128 Ga0495644_0011103 3300046523 Bacteria 3472
129 Ga0495648_0064124 3300046524 Bacteria 2165
130 Ga0495609_0014957 3300046538 Bacteria 3640
131 Ga0495633_0000027 3300046558 Bacteria 204613
132 Ga0495668_0000112 3300046616 Bacteria 128501
133 Ga0495625_0000785 3300046660 Bacteria 44141
134 Ga0495625_0001065 3300046660 Bacteria 35829
135 Ga0495625_0018343 3300046660 Bacteria 5465
136 Ga0495625_0023222 3300046660 Bacteria 4740
137 Ga0495625_0059299 3300046660 Bacteria 2716
138 Ga0495625_0074570 3300046660 Bacteria 2376
139 Ga0495661_0008288 3300046665 Bacteria 7201
140 Ga0495686_0001369 3300047472 Bacteria 27183
141 Ga0495686_0002549 3300047472 Bacteria 17008
142 Ga0495686_0008395 3300047472 Bacteria 7579
143 Ga0495614_0016408 3300048089 Bacteria 3223
144 Ga0495678_009955 3300049459 Bacteria 4656
145 nmdc:mga0k408_1074_c1 3300050493 Bacteria 15034
146 nmdc:mga0k408_1340_c1 3300050493 Bacteria 13307
147 Ga0500635_0000314 3300053080 Bacteria 16905
148 Ga0500608_088076 3300053122 Bacteria 1455
149 Ga0500618_000012 3300053125 Bacteria 185382
150 Ga0500642_0044235 3300053130 Bacteria 1938
151 Ga0500564_027920 3300053138 Bacteria 2599
152 Ga0500579_113236 3300053143 Bacteria 1354
153 Ga0500616_0028434 3300053153 Bacteria 3081
154 Ga0500622_0003214 3300053156 Bacteria 11110
155 Ga0500624_000368 3300053157 Bacteria 14523

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046523 Ga0495644_0011103 Ga0495644_0011103_2528_3127 199
2 3300046462 Ga0495651_0144139 Ga0495651_0144139_123_728 201
3 3300046660 Ga0495625_0018343 Ga0495625_0018343_2919_3527 202
4 3300050493 nmdc:mga0k408_1340_c1 nmdc:mga0k408_1340_c1_11638_12246 202
5 3300046492 Ga0495585_0000947 Ga0495585_0000947_10520_11134 204
6 3300046524 Ga0495648_0064124 Ga0495648_0064124_846_1460 204
7 3300046660 Ga0495625_0001065 Ga0495625_0001065_35007_35621 204
8 3300046660 Ga0495625_0059299 Ga0495625_0059299_1276_1890 204
9 3300037418 Ga0395900_0000095 Ga0395900_0000095_56801_57475 205
10 3300046507 Ga0495606_0000035 Ga0495606_0000035_182632_183252 206
11 3300044656 Ga0466969_0057262 Ga0466969_0057262_1162_1785 207
12 3300045836 Ga0466958_0039001 Ga0466958_0039001_246_869 207
13 3300009093 Ga0105240_10120121 Ga0105240_101201213 209
14 3300017792 Ga0163161_10182617 Ga0163161_101826172 212
15 3300053122 Ga0500608_088076 Ga0500608_088076_333_1004 213
16 3300005563 Ga0068855_100035707 Ga0068855_1000357076 214
17 3300005578 Ga0068854_100083955 Ga0068854_1000839551 214
18 3300010375 Ga0105239_10052735 Ga0105239_100527355 214
19 3300025914 Ga0207671_10048644 Ga0207671_100486444 214
20 3300025949 Ga0207667_10310349 Ga0207667_103103492 214
21 3300025981 Ga0207640_10039754 Ga0207640_100397541 214
22 3300046507 Ga0495606_0076076 Ga0495606_0076076_1265_1978 214
23 3300053138 Ga0500564_027920 Ga0500564_027920_1775_2446 214
24 3300053153 Ga0500616_0028434 Ga0500616_0028434_456_1127 214
25 3300003323 rootH1_10033715 rootH1_100337152 215
26 3300005339 Ga0070660_100350836 Ga0070660_1003508361 215
27 3300005539 Ga0068853_100059873 Ga0068853_1000598734 215
28 3300005563 Ga0068855_100011192 Ga0068855_10001119210 215
29 3300009093 Ga0105240_10046849 Ga0105240_100468491 215
30 3300009176 Ga0105242_10789214 Ga0105242_107892141 215
31 3300025913 Ga0207695_10061361 Ga0207695_100613612 215
32 3300025949 Ga0207667_10007607 Ga0207667_100076075 215
33 3300026041 Ga0207639_10018597 Ga0207639_100185976 215
34 3300042005 Ga0439448_0017709 Ga0439448_0017709_669_1340 215
35 iso_pu_bacteria 2977232053 2977236378 217
36 3300025914 Ga0207671_10011083 Ga0207671_100110836 218
37 3300039447 Ga0436361_0269064 Ga0436361_0269064_2409_3083 219
38 iso_pu_bacteria 2919437846 2919438434 219
39 3300001990 JGI24737J22298_10003858 JGI24737J22298_100038582 220
40 3300002067 JGI24735J21928_10005118 JGI24735J21928_100051183 220
41 3300005288 Ga0065714_10176766 Ga0065714_101767661 220
42 3300005366 Ga0070659_100196982 Ga0070659_1001969822 220
43 3300006195 Ga0075366_10000801 Ga0075366_1000080111 220
44 3300013100 Ga0157373_10013923 Ga0157373_100139235 220
45 3300013102 Ga0157371_10000849 Ga0157371_1000084918 220
46 3300013104 Ga0157370_10011311 Ga0157370_100113116 220
47 3300013306 Ga0163162_10693247 Ga0163162_106932472 220
48 3300013307 Ga0157372_10008123 Ga0157372_1000812310 220
49 3300025904 Ga0207647_10000128 Ga0207647_1000012845 220
50 3300025932 Ga0207690_10141639 Ga0207690_101416392 220
51 3300026116 Ga0207674_10257281 Ga0207674_102572812 220
52 3300028794 Ga0307515_10002940 Ga0307515_100029403 220
53 3300046507 Ga0495606_0045984 Ga0495606_0045984_1561_2223 220
54 3300046558 Ga0495633_0000027 Ga0495633_0000027_90834_91496 220
55 3300046660 Ga0495625_0000785 Ga0495625_0000785_42711_43373 220
56 3300050493 nmdc:mga0k408_1074_c1 nmdc:mga0k408_1074_c1_7710_8372 220
57 3300053125 Ga0500618_000012 Ga0500618_000012_180911_181573 220
58 3300003323 rootH1_10202357 rootH1_102023572 221
59 3300013296 Ga0157374_10117555 Ga0157374_101175552 221
60 3300013306 Ga0163162_10007180 Ga0163162_1000718010 221
61 3300025921 Ga0207652_10219522 Ga0207652_102195222 221
62 3300046665 Ga0495661_0008288 Ga0495661_0008288_6419_7084 221
63 3300047472 Ga0495686_0001369 Ga0495686_0001369_365_1030 221
64 3300053156 Ga0500622_0003214 Ga0500622_0003214_3841_4506 221
65 3300003320 rootH2_10051744 rootH2_100517441 222
66 3300003323 rootH1_10029533 rootH1_1002953321 222
67 3300006237 Ga0097621_100681060 Ga0097621_1006810601 222
68 3300009093 Ga0105240_10036278 Ga0105240_100362783 222
69 3300009174 Ga0105241_10453556 Ga0105241_104535561 222
70 3300010375 Ga0105239_10000001 Ga0105239_10000001176 222
71 3300010375 Ga0105239_10003333 Ga0105239_1000333317 222
72 3300025913 Ga0207695_10040951 Ga0207695_100409514 222
73 3300025937 Ga0207669_10354814 Ga0207669_103548142 222
74 3300033179 Ga0307507_10000036 Ga0307507_1000003658 222
75 3300037312 Ga0395899_0000001 Ga0395899_0000001_629567_630235 222
76 3300047472 Ga0495686_0008395 Ga0495686_0008395_5190_5858 222
77 iso_pu_bacteria 2852623160 2852624638 222
78 iso_pu_bacteria 2884933994 2884936478 222
79 3300002737 JGI25162J39368_1000059 JGI25162J39368_100005948 223
80 3300002737 JGI25162J39368_1000823 JGI25162J39368_100082316 223
81 3300002737 JGI25162J39368_1000899 JGI25162J39368_100089912 223
82 3300002741 JGI25157J39369_1012460 JGI25157J39369_10124601 223
83 3300002772 JGI25164J39214_1000963 JGI25164J39214_10009638 223
84 3300003214 JGI25165J46597_1000739 JGI25165J46597_100073919 223
85 3300003320 rootH2_10056133 rootH2_100561333 223
86 3300005336 Ga0070680_100007736 Ga0070680_1000077367 223
87 3300005458 Ga0070681_10000745 Ga0070681_1000074521 223
88 3300005530 Ga0070679_100008263 Ga0070679_1000082637 223
89 3300005530 Ga0070679_100398035 Ga0070679_1003980352 223
90 3300005563 Ga0068855_100000342 Ga0068855_10000034212 223
91 3300005577 Ga0068857_100070048 Ga0068857_1000700482 223
92 3300005614 Ga0068856_100020764 Ga0068856_1000207643 223
93 3300005614 Ga0068856_100568071 Ga0068856_1005680711 223
94 3300009093 Ga0105240_10000200 Ga0105240_100002004 223
95 3300009093 Ga0105240_10193664 Ga0105240_101936642 223
96 3300009174 Ga0105241_10039240 Ga0105241_100392402 223
97 3300009174 Ga0105241_10329409 Ga0105241_103294092 223
98 3300009545 Ga0105237_10000239 Ga0105237_1000023953 223
99 3300009545 Ga0105237_10007163 Ga0105237_1000716310 223
100 3300009551 Ga0105238_10450189 Ga0105238_104501893 223
101 3300010375 Ga0105239_10000059 Ga0105239_1000005970 223
102 3300010375 Ga0105239_10001792 Ga0105239_1000179224 223
103 3300013306 Ga0163162_10000116 Ga0163162_1000011617 223
104 3300013306 Ga0163162_11002645 Ga0163162_110026451 223
105 3300025231 Ga0207427_100066 Ga0207427_1000662 223
106 3300025233 Ga0209437_100010 Ga0209437_100010117 223
107 3300025233 Ga0209437_100169 Ga0209437_10016992 223
108 3300025250 Ga0209026_1004175 Ga0209026_10041753 223
109 3300025254 Ga0209148_1012091 Ga0209148_10120912 223
110 3300025258 Ga0209129_1006486 Ga0209129_10064864 223
111 3300025261 Ga0209233_1000017 Ga0209233_1000017130 223
112 3300025272 Ga0209455_1001199 Ga0209455_100119910 223
113 3300025909 Ga0207705_10184959 Ga0207705_101849592 223
114 3300025911 Ga0207654_10018195 Ga0207654_100181952 223
115 3300025912 Ga0207707_10024568 Ga0207707_100245686 223
116 3300025913 Ga0207695_10000055 Ga0207695_100000554 223
117 3300025913 Ga0207695_10188241 Ga0207695_101882412 223
118 3300025914 Ga0207671_10002729 Ga0207671_100027293 223
119 3300025917 Ga0207660_10027265 Ga0207660_100272652 223
120 3300025949 Ga0207667_10003651 Ga0207667_1000365111 223
121 3300026078 Ga0207702_10055367 Ga0207702_100553672 223
122 3300028379 Ga0268266_10000111 Ga0268266_10000111126 223
123 3300028794 Ga0307515_10001027 Ga0307515_100010278 223
124 3300031456 Ga0307513_10620149 Ga0307513_106201491 223
125 3300037418 Ga0395900_0000370 Ga0395900_0000370_25544_26215 223
126 3300037466 Ga0395898_0051852 Ga0395898_0051852_3028_3699 223
127 3300037471 Ga0395905_0000529 Ga0395905_0000529_26336_27007 223
128 3300038443 Ga0395901_0000580 Ga0395901_0000580_25314_25985 223
129 3300046513 Ga0495616_0029122 Ga0495616_0029122_1700_2371 223
130 3300046518 Ga0495631_0182761 Ga0495631_0182761_69_740 223
131 3300046538 Ga0495609_0014957 Ga0495609_0014957_2240_2911 223
132 3300046616 Ga0495668_0000112 Ga0495668_0000112_41962_42633 223
133 3300046660 Ga0495625_0023222 Ga0495625_0023222_364_1035 223
134 3300046660 Ga0495625_0074570 Ga0495625_0074570_83_754 223
135 3300047472 Ga0495686_0002549 Ga0495686_0002549_1778_2485 223
136 3300048089 Ga0495614_0016408 Ga0495614_0016408_119_790 223
137 3300049459 Ga0495678_009955 Ga0495678_009955_339_1010 223
138 3300053080 Ga0500635_0000314 Ga0500635_0000314_6132_6803 223
139 3300053130 Ga0500642_0044235 Ga0500642_0044235_956_1627 223
140 3300053143 Ga0500579_113236 Ga0500579_113236_276_947 223
141 3300053157 Ga0500624_000368 Ga0500624_000368_12263_12934 223
142 3300010375 Ga0105239_10266971 Ga0105239_102669712 224
143 3300013308 Ga0157375_10015825 Ga0157375_100158257 224
144 3300025931 Ga0207644_10014566 Ga0207644_100145662 224
145 3300025949 Ga0207667_10433981 Ga0207667_104339812 224
146 3300028800 Ga0265338_10336679 Ga0265338_103366792 224
147 3300005614 Ga0068856_100686420 Ga0068856_1006864201 225
148 3300025949 Ga0207667_10000015 Ga0207667_10000015268 225
149 3300026078 Ga0207702_10555569 Ga0207702_105555692 225
150 3300001979 JGI24740J21852_10018922 JGI24740J21852_100189222 226
151 3300005455 Ga0070663_100034329 Ga0070663_1000343292 226
152 3300013102 Ga0157371_10000805 Ga0157371_100008057 226
153 3300013104 Ga0157370_10045132 Ga0157370_100451322 226
154 3300013105 Ga0157369_10000664 Ga0157369_1000066430 226
155 3300013307 Ga0157372_10000109 Ga0157372_1000010943 226
156 3300026067 Ga0207678_10116228 Ga0207678_101162281 226
157 3300037312 Ga0395899_0003279 Ga0395899_0003279_6494_7174 226
158 3300037418 Ga0395900_0085062 Ga0395900_0085062_289_969 226

Structural Annotation

Top 5 Hits

ID Description Score Start End
7dy4-assembly2.cif.gz_G high resolution crystal structure of hemoglobin m boston. 0.3555 80 209
2w72-assembly1.cif.gz_C deoxygenated structure of a distal site hemoglobin mutant plus xe 0.3551 80 209
6kai-assembly2.cif.gz_E crosslinked alpha(ni)-beta(fe) human hemoglobin a in the t quaternary structure at 95 k: light 0.3534 80 209
1v4x-assembly1.cif.gz_A crystal structure of bluefin tuna hemoglobin deoxy form at ph5.0 0.352 104 209
1out-assembly1.cif.gz_A trout hemoglobin i 0.3517 80 209
ID Description Score Start End Superfamily
af_Q7FB56_1_199_1.20.1560.10 Mainly Alpha;Up-down Bundle;ABC transporter transmembrane region fold;ABC transporter type 1, transmembrane domain 0.3727 60 226 1.20.1560.10
1hdaD00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.3545 85 208 1.10.490.10
af_O43008_86_182_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.3534 62 151 1.10.472.10
1spgA00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.3484 104 209 1.10.490.10
5kerH00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.3475 80 208 1.10.490.10
ID Description Score Start End GO Terms
AF-A0A554SM20-F1-model_v4 deleted 0.9927 1 220
AF-A0A4Q3ENN0-F1-model_v4 DUF479 domain-containing protein 0.9842 1 222
AF-A0A4U1GMN9-F1-model_v4 DUF479 domain-containing protein 0.9801 1 221
AF-A0A4Q3ENN0-F1-model_v4 DUF479 domain-containing protein 0.9798 1 222
AF-A0A4V1T2D9-F1-model_v4 DUF479 domain-containing protein 0.9789 1 162

Feature Viewer

pLDDT pTM Quality
93.17 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map