F229639

General Info

Members Datasets Scaffolds Average Seq Length
158 119 316 342

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10120920|Ga0105249_101209203
Length 393
Sequence VQADDAADAPRPRLDLDSARDSCAAPICGGAVCPAAHYTAQSQSVLGKSSMSVGYQAVSWNRQKRIYDVVLAGFVASYLAIFIGAGSVVQRNATAETLLIRGFGTLSLLLLHVILCIGPLCRLNRRFLPLLYNRRHLGVTMFFFALAHGVFSIVQFHALGDLNPLVSLFVSNTRYNSVAEFPFQALGFFALVILFLMAATSHDFWLHNLSAPVWKRIHMMVYPAYGLLIAHVSLGALQSETSPWLSGLLGLGIIVVITLHVSAAMKERCLDRECTDAVADGFIEVGEVRSIPENRAKVVTLSGERVAVFRYGGKVSAISNVCRHQNGPLGEGRIIDGCITCPWHGYQYLPDSGASPPPFTEKVPTFQTKIVGTKVLVHPCAHPPGTRLEPAVL

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
43 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
44 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
70 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
71 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
72 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
73 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
74 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
75 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
76 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
77 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
78 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
80 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
81 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
82 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
83 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
84 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
85 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
86 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
87 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
88 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
89 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
90 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
91 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
92 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
93 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
94 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
95 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
96 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
97 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
98 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
99 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
100 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
101 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
102 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
103 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
104 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
105 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
106 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
107 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
108 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
112 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
113 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
114 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
115 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
116 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
117 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
118 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
119 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.9
Nodule 0
Rhizoplane 4.43
Rhizosphere 88.61
Stem 0
Stem Tuber 0
Unclassified 21.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_10120920 3300009553 Bacteria 2488
2 rootH2_10147796 3300003320 Bacteria 1894
3 rootH2_10311885 3300003320 Bacteria 1217
4 rootL2_10032979 3300003322 Bacteria 2378
5 rootH1_10066334 3300003323 Unclassified 2152
6 rootH1_10126093 3300003323 Bacteria 2336
7 Ga0070670_100107687 3300005331 Bacteria 2401
8 Ga0068869_100005686 3300005334 Bacteria 7864
9 Ga0068868_100022675 3300005338 Bacteria 4743
10 Ga0070671_100026734 3300005355 Bacteria 4746
11 Ga0070709_10017648 3300005434 Bacteria 4098
12 Ga0070709_10020928 3300005434 Unclassified 3806
13 Ga0070714_100127769 3300005435 Bacteria 2268
14 Ga0070713_100123396 3300005436 Unclassified 2275
15 Ga0070710_10024565 3300005437 Bacteria 3181
16 Ga0070711_100039866 3300005439 Unclassified 3165
17 Ga0070711_100040353 3300005439 Bacteria 3147
18 Ga0070708_100024809 3300005445 Bacteria 5121
19 Ga0070706_100304329 3300005467 Bacteria 1487
20 Ga0070698_100229690 3300005471 Bacteria 1789
21 Ga0068855_100095556 3300005563 Bacteria 3425
22 Ga0068857_100031820 3300005577 Unclassified 4661
23 Ga0068859_100022686 3300005617 Bacteria 6293
24 Ga0068859_100048752 3300005617 Bacteria 4255
25 Ga0068864_100461273 3300005618 Bacteria 1216
26 Ga0068863_100068025 3300005841 Unclassified 3369
27 Ga0068858_100000654 3300005842 Bacteria 36157
28 Ga0068860_100032132 3300005843 Bacteria 5046
29 Ga0070717_10048610 3300006028 Bacteria 3480
30 Ga0070717_10134887 3300006028 Bacteria 2125
31 Ga0070716_100014396 3300006173 Bacteria 4050
32 Ga0070712_100022271 3300006175 Bacteria 4172
33 Ga0070712_100379843 3300006175 Bacteria 1163
34 Ga0075367_10018962 3300006178 Bacteria 3806
35 Ga0075366_10161783 3300006195 Bacteria 1357
36 Ga0068871_100235385 3300006358 Unclassified 1591
37 Ga0075431_100122268 3300006847 Bacteria 2686
38 Ga0097620_100022686 3300006931 Bacteria 6293
39 Ga0097620_100048752 3300006931 Bacteria 4255
40 Ga0105251_10134205 3300009011 Bacteria 1121
41 Ga0105240_10073688 3300009093 Unclassified 4216
42 Ga0105240_10075121 3300009093 Unclassified 4169
43 Ga0105245_10069719 3300009098 Unclassified 3188
44 Ga0105245_10084480 3300009098 Bacteria 2908
45 Ga0105245_10288369 3300009098 Unclassified 1607
46 Ga0105245_10459392 3300009098 Bacteria 1283
47 Ga0105248_10241834 3300009177 Unclassified 2032
48 Ga0105237_10026539 3300009545 Bacteria 5920
49 Ga0105249_10216208 3300009553 Unclassified 1884
50 Ga0105239_10012181 3300010375 Bacteria 9587
51 Ga0105239_10182787 3300010375 Unclassified 2346
52 Ga0157374_10000220 3300013296 Bacteria 52590
53 Ga0157374_10000571 3300013296 Bacteria 32685
54 Ga0163162_10001675 3300013306 Bacteria 20776
55 Ga0163162_10005185 3300013306 Bacteria 12569
56 Ga0163162_10620196 3300013306 Bacteria 1207
57 Ga0157375_10000572 3300013308 Bacteria 32960
58 Ga0157375_10145533 3300013308 Unclassified 2500
59 Ga0163163_10033517 3300014325 Bacteria 4969
60 Ga0163163_10040199 3300014325 Bacteria 4566
61 Ga0163163_10090412 3300014325 Bacteria 3074
62 Ga0163163_10093090 3300014325 Unclassified 3030
63 Ga0157377_10095689 3300014745 Bacteria 1761
64 Ga0163161_10224200 3300017792 Bacteria 1457
65 Ga0207692_10017658 3300025898 Bacteria 3186
66 Ga0207680_10067316 3300025903 Unclassified 2206
67 Ga0207699_10029261 3300025906 Bacteria 3071
68 Ga0207684_10241285 3300025910 Bacteria 1559
69 Ga0207695_10076507 3300025913 Unclassified 3402
70 Ga0207695_10085197 3300025913 Bacteria 3189
71 Ga0207693_10034678 3300025915 Bacteria 3980
72 Ga0207693_10052811 3300025915 Bacteria 3188
73 Ga0207663_10063598 3300025916 Bacteria 2351
74 Ga0207694_10227267 3300025924 Bacteria 1523
75 Ga0207650_10091620 3300025925 Bacteria 2323
76 Ga0207700_10109969 3300025928 Unclassified 2216
77 Ga0207664_10122297 3300025929 Bacteria 2180
78 Ga0207706_10181344 3300025933 Unclassified 1849
79 Ga0207704_10002327 3300025938 Bacteria 8537
80 Ga0207665_10029096 3300025939 Bacteria 3653
81 Ga0207665_10184849 3300025939 Bacteria 1511
82 Ga0207711_10110666 3300025941 Bacteria 2442
83 Ga0207711_10240632 3300025941 Bacteria 1659
84 Ga0207689_10003974 3300025942 Bacteria 13450
85 Ga0207677_10013240 3300026023 Bacteria 4772
86 Ga0207703_10072643 3300026035 Unclassified 2844
87 Ga0207702_10008581 3300026078 Bacteria 8615
88 Ga0207702_10359628 3300026078 Bacteria 1395
89 Ga0207641_10271755 3300026088 Unclassified 1591
90 Ga0207641_10343006 3300026088 Bacteria 1422
91 Ga0207676_10241166 3300026095 Bacteria 1622
92 Ga0207674_10018040 3300026116 Bacteria 7686
93 Ga0207698_10286381 3300026142 Bacteria 1526
94 Ga0268266_10135700 3300028379 Unclassified 2204
95 Ga0268264_10062471 3300028381 Unclassified 3128
96 Ga0268264_10099372 3300028381 Unclassified 2525
97 Ga0268264_10341996 3300028381 Bacteria 1421
98 Ga0265338_10002984 3300028800 Bacteria 24519
99 Ga0265316_10118170 3300031344 Bacteria 2004
100 Ga0307508_10000039 3300031616 Bacteria 149732
101 Ga0307410_10014009 3300031852 Bacteria 4701
102 Ga0307407_10000574 3300031903 Bacteria 11601
103 Ga0307411_10103657 3300032005 Bacteria 2018
104 Ga0373945_0002078 3300035116 Bacteria 6237
105 Ga0373927_0122840 3300035695 Bacteria 1695
106 Ga0373933_0090282 3300035724 Bacteria 1890
107 Ga0373925_0069957 3300037068 Unclassified 2652
108 Ga0395905_0117182 3300037471 Bacteria 2503
109 Ga0395905_0123098 3300037471 Bacteria 2439
110 Ga0436365_1276050 3300039437 Bacteria 5028
111 Ga0436361_0033741 3300039447 Bacteria 7213
112 Ga0466957_0133418 3300044842 Unclassified 1594
113 Ga0451576_0079368 3300045051 Unclassified 3415
114 Ga0495603_0039191 3300046455 Bacteria 2840
115 Ga0495651_0000700 3300046462 Bacteria 26057
116 Ga0495580_0000362 3300046472 Bacteria 37023
117 Ga0495580_0013391 3300046472 Bacteria 6261
118 Ga0495580_0019255 3300046472 Bacteria 5072
119 Ga0495580_0037944 3300046472 Bacteria 3454
120 Ga0495582_0020096 3300046473 Bacteria 3654
121 Ga0495582_0073118 3300046473 Bacteria 1898
122 Ga0495639_0006875 3300046475 Bacteria 4887
123 Ga0495662_0158501 3300046476 Bacteria 1115
124 Ga0495594_0143138 3300046499 Bacteria 1356
125 Ga0495608_0016201 3300046511 Bacteria 5157
126 Ga0495665_0045701 3300046531 Unclassified 2326
127 Ga0495667_0003274 3300046559 Bacteria 10856
128 Ga0495599_0062476 3300046678 Unclassified 2327
129 Ga0495623_0030399 3300046679 Bacteria 3474
130 Ga0495658_0015885 3300046683 Bacteria 3869
131 Ga0495658_0079266 3300046683 Bacteria 1924
132 Ga0495676_0165286 3300047321 Bacteria 1562
133 Ga0495680_0049623 3300047322 Bacteria 3287
134 Ga0495675_0000563 3300047444 Bacteria 23969
135 Ga0495684_0000351 3300047471 Bacteria 37160
136 Ga0495684_0275484 3300047471 Unclassified 1216
137 Ga0495602_0010987 3300048088 Bacteria 9377
138 Ga0495602_0114167 3300048088 Bacteria 2188
139 Ga0496104_0051988 3300048907 Bacteria 3869
140 Ga0496104_0183603 3300048907 Bacteria 2002
141 Ga0496105_0162493 3300048908 Bacteria 1833
142 Ga0496107_0126139 3300048910 Unclassified 1888
143 Ga0496111_0233742 3300048914 Bacteria 1365
144 Ga0496112_0005071 3300048915 Bacteria 11318
145 Ga0496114_0176341 3300048917 Unclassified 1865
146 Ga0496119_0005414 3300048922 Bacteria 12254
147 Ga0501034_0044412 3300049571 Bacteria 4495
148 Ga0501047_0158776 3300049581 Bacteria 2133
149 Ga0501047_0200069 3300049581 Bacteria 1859
150 Ga0501080_0064733 3300049742 Bacteria 3400
151 Ga0501044_0000235 3300049823 Bacteria 69800
152 nmdc:mga0qj67_206868_c1 3300050509 Bacteria 1594
153 nmdc:mga0n895_210595_c1 3300050512 Bacteria 1974
154 Ga0500568_0031651 3300053139 Bacteria 2180
155 Ga0590071_023479 3300059421 Unclassified 1458
156 Ga0590074_000292 3300059423 Bacteria 6816
157 Ga0590077_000934 3300059426 Bacteria 7464
158 Ga0501082_0123581 3300060353 Bacteria 2244
159 Ga0105249_10120920
160 rootH2_10147796
161 rootH2_10311885
162 rootL2_10032979
163 rootH1_10066334
164 rootH1_10126093
165 Ga0070670_100107687
166 Ga0068869_100005686
167 Ga0068868_100022675
168 Ga0070671_100026734
169 Ga0070709_10017648
170 Ga0070709_10020928
171 Ga0070714_100127769
172 Ga0070713_100123396
173 Ga0070710_10024565
174 Ga0070711_100039866
175 Ga0070711_100040353
176 Ga0070708_100024809
177 Ga0070706_100304329
178 Ga0070698_100229690
179 Ga0068855_100095556
180 Ga0068857_100031820
181 Ga0068859_100022686
182 Ga0068859_100048752
183 Ga0068864_100461273
184 Ga0068863_100068025
185 Ga0068858_100000654
186 Ga0068860_100032132
187 Ga0070717_10048610
188 Ga0070717_10134887
189 Ga0070716_100014396
190 Ga0070712_100022271
191 Ga0070712_100379843
192 Ga0075367_10018962
193 Ga0075366_10161783
194 Ga0068871_100235385
195 Ga0075431_100122268
196 Ga0097620_100022686
197 Ga0097620_100048752
198 Ga0105251_10134205
199 Ga0105240_10073688
200 Ga0105240_10075121
201 Ga0105245_10069719
202 Ga0105245_10084480
203 Ga0105245_10288369
204 Ga0105245_10459392
205 Ga0105248_10241834
206 Ga0105237_10026539
207 Ga0105249_10216208
208 Ga0105239_10012181
209 Ga0105239_10182787
210 Ga0157374_10000220
211 Ga0157374_10000571
212 Ga0163162_10001675
213 Ga0163162_10005185
214 Ga0163162_10620196
215 Ga0157375_10000572
216 Ga0157375_10145533
217 Ga0163163_10033517
218 Ga0163163_10040199
219 Ga0163163_10090412
220 Ga0163163_10093090
221 Ga0157377_10095689
222 Ga0163161_10224200
223 Ga0207692_10017658
224 Ga0207680_10067316
225 Ga0207699_10029261
226 Ga0207684_10241285
227 Ga0207695_10076507
228 Ga0207695_10085197
229 Ga0207693_10034678
230 Ga0207693_10052811
231 Ga0207663_10063598
232 Ga0207694_10227267
233 Ga0207650_10091620
234 Ga0207700_10109969
235 Ga0207664_10122297
236 Ga0207706_10181344
237 Ga0207704_10002327
238 Ga0207665_10029096
239 Ga0207665_10184849
240 Ga0207711_10110666
241 Ga0207711_10240632
242 Ga0207689_10003974
243 Ga0207677_10013240
244 Ga0207703_10072643
245 Ga0207702_10008581
246 Ga0207702_10359628
247 Ga0207641_10271755
248 Ga0207641_10343006
249 Ga0207676_10241166
250 Ga0207674_10018040
251 Ga0207698_10286381
252 Ga0268266_10135700
253 Ga0268264_10062471
254 Ga0268264_10099372
255 Ga0268264_10341996
256 Ga0265338_10002984
257 Ga0265316_10118170
258 Ga0307508_10000039
259 Ga0307410_10014009
260 Ga0307407_10000574
261 Ga0307411_10103657
262 Ga0373945_0002078
263 Ga0373927_0122840
264 Ga0373933_0090282
265 Ga0373925_0069957
266 Ga0395905_0117182
267 Ga0395905_0123098
268 Ga0436365_1276050
269 Ga0436361_0033741
270 Ga0466957_0133418
271 Ga0451576_0079368
272 Ga0495603_0039191
273 Ga0495651_0000700
274 Ga0495580_0000362
275 Ga0495580_0013391
276 Ga0495580_0019255
277 Ga0495580_0037944
278 Ga0495582_0020096
279 Ga0495582_0073118
280 Ga0495639_0006875
281 Ga0495662_0158501
282 Ga0495594_0143138
283 Ga0495608_0016201
284 Ga0495665_0045701
285 Ga0495667_0003274
286 Ga0495599_0062476
287 Ga0495623_0030399
288 Ga0495658_0015885
289 Ga0495658_0079266
290 Ga0495676_0165286
291 Ga0495680_0049623
292 Ga0495675_0000563
293 Ga0495684_0000351
294 Ga0495684_0275484
295 Ga0495602_0010987
296 Ga0495602_0114167
297 Ga0496104_0051988
298 Ga0496104_0183603
299 Ga0496105_0162493
300 Ga0496107_0126139
301 Ga0496111_0233742
302 Ga0496112_0005071
303 Ga0496114_0176341
304 Ga0496119_0005414
305 Ga0501034_0044412
306 Ga0501047_0158776
307 Ga0501047_0200069
308 Ga0501080_0064733
309 Ga0501044_0000235
310 nmdc:mga0qj67_206868_c1
311 nmdc:mga0n895_210595_c1
312 Ga0500568_0031651
313 Ga0590071_023479
314 Ga0590074_000292
315 Ga0590077_000934
316 Ga0501082_0123581

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13806

Rieske_2

Rieske-like [2Fe-2S] domain

281

378

0.96

PF01794

Ferric_reduct

Ferric reductase like transmembrane component

102

229

0.94

PF00355

Rieske

Rieske [2Fe-2S] domain

281

367

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wnd-assembly1.cif.gz_A structure of the rieske non-heme iron oxygenase gxta with dideoxysaxitoxin bound 0.8075 211 310
6wnc-assembly1.cif.gz_B-2 structure of the rieske non-heme iron oxygenase gxta 0.798 210 310
4emj-assembly1.cif.gz_B complex between the reductase and ferredoxin components of toluene dioxygenase 0.7975 211 307
3c0d-assembly3.cif.gz_C crystal structure of the putative nitrite reductase nadph (small subunit) oxidoreductase protein q87hb1. northeast structural genomics consortium target vpr162 0.7967 211 307
6wnd-assembly1.cif.gz_C-3 structure of the rieske non-heme iron oxygenase gxta with dideoxysaxitoxin bound 0.7959 210 310
ID Description Score Start End Superfamily
3gkqC02 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.8916 210 310 2.20.25.680
1z01A02 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.8739 210 310 2.20.25.680
3gkqC02 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.8488 210 310 2.20.25.680
af_Q2FVL9_1_103_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8438 211 307 2.102.10.10
af_Q8IBP8_93_209_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8186 211 310 2.102.10.10
ID Description Score Start End GO Terms
AF-A0A7X5WNW1-F1-model_v4 (2Fe-2S)-binding protein 0.9423 1 121 GO:0016020
AF-A0A7X5WNW1-F1-model_v4 (2Fe-2S)-binding protein 0.9201 1 121 GO:0016020
AF-A0A6M0AG28-F1-model_v4 (2Fe-2S)-binding protein 0.9155 1 164 GO:0016020
AF-A0A6M0AG28-F1-model_v4 (2Fe-2S)-binding protein 0.905 1 164 GO:0016020
AF-A0A3C0MHI8-F1-model_v4 (2Fe-2S)-binding protein 0.9044 1 201 GO:0005886
GO:0010181
GO:0016679
GO:0020037

Map