F229579

General Info

Members Datasets Scaffolds Average Seq Length
158 65 158 186

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_11769137|Ga0114129_117691372
Length 210
Sequence MRGSNYRAPRKYCCGQKHRWELDKMSLRVIGGKAKGRKLKSVPGDTTRPITDRAKESLFNILSGDVIDSNWWDLFAGTGAVGIEALSRGAAFVRFTDMNRAPIDTINFNVEHCGLSGQAEIRRADAFTYLAAATDKRFEYIYIAPPQYKDMWLKALELVDDNTAWLADDAWVIVQIAPREYRDAKPELKHLEEFEQRKYGSTLLVFYERK

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
6 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
7 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
8 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
9 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
10 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
11 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
12 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
14 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
15 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
16 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
17 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
18 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
19 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
20 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
22 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
23 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
24 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
25 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
26 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
32 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
34 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
35 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
36 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
37 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
38 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
39 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
40 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
41 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
42 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
43 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
44 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
45 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
46 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
47 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
48 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
49 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
50 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
51 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
52 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
53 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
54 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
55 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
56 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
57 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
58 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
59 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
60 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
61 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
62 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
63 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
64 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
65 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10007652 3300003203 Bacteria 4917
2 JGI25406J46586_10079466 3300003203 Bacteria 1009
3 Ga0065704_10000630 3300005289 Bacteria 17936
4 Ga0065704_10469248 3300005289 Unclassified 690
5 Ga0065707_10000939 3300005295 Bacteria 17037
6 Ga0065707_10087849 3300005295 Unclassified 4867
7 Ga0065707_10148207 3300005295 Unclassified 1689
8 Ga0070689_100673384 3300005340 Unclassified 902
9 Ga0070705_100282363 3300005440 Bacteria 1181
10 Ga0070707_100661697 3300005468 Bacteria 1007
11 Ga0070698_100019583 3300005471 Bacteria 7100
12 Ga0070698_100047417 3300005471 Unclassified 4392
13 Ga0070698_100142245 3300005471 Bacteria 2350
14 Ga0070699_100001469 3300005518 Bacteria 21556
15 Ga0070699_100017893 3300005518 Bacteria 6085
16 Ga0070699_100044275 3300005518 Bacteria 3854
17 Ga0070704_100157479 3300005549 Bacteria 1793
18 Ga0070704_100663145 3300005549 Bacteria 922
19 Ga0068859_100207121 3300005617 Bacteria 2047
20 Ga0068862_100131665 3300005844 Bacteria 2212
21 Ga0081539_10025754 3300005985 Bacteria 3775
22 Ga0075427_10002379 3300006194 Bacteria 2517
23 Ga0075428_100045344 3300006844 Unclassified 4831
24 Ga0075428_100048794 3300006844 Bacteria 4646
25 Ga0075428_100073260 3300006844 Bacteria 3740
26 Ga0075428_100586623 3300006844 Bacteria 1191
27 Ga0075430_100055018 3300006846 Bacteria 3347
28 Ga0075430_100444237 3300006846 Bacteria 1070
29 Ga0075431_100015750 3300006847 Bacteria 7666
30 Ga0075431_100317457 3300006847 Bacteria 1572
31 Ga0075431_100404955 3300006847 Unclassified 1365
32 Ga0075431_100783656 3300006847 Unclassified 927
33 Ga0075433_10064365 3300006852 Bacteria 3214
34 Ga0075433_10308471 3300006852 Unclassified 1401
35 Ga0075429_100004051 3300006880 Bacteria 12551
36 Ga0075429_100104495 3300006880 Bacteria 2474
37 Ga0075429_100125109 3300006880 Bacteria 2248
38 Ga0075429_100185147 3300006880 Bacteria 1825
39 Ga0075429_100880663 3300006880 Bacteria 784
40 Ga0097620_100207105 3300006931 Bacteria 2047
41 Ga0114129_10001947 3300009147 Bacteria 28281
42 Ga0114129_10008547 3300009147 Bacteria 14596
43 Ga0114129_10011326 3300009147 Bacteria 12705
44 Ga0114129_10057780 3300009147 Bacteria 5427
45 Ga0114129_10061505 3300009147 Bacteria 5247
46 Ga0114129_10123675 3300009147 Unclassified 3558
47 Ga0114129_10287700 3300009147 Unclassified 2194
48 Ga0114129_10299551 3300009147 Bacteria 2144
49 Ga0114129_10775288 3300009147 Unclassified 1225
50 Ga0114129_11769137 3300009147 Unclassified 752
51 Ga0105243_10418648 3300009148 Unclassified 1249
52 Ga0105242_10116282 3300009176 Bacteria 2288
53 Ga0105249_10303547 3300009553 Bacteria 1602
54 Ga0105249_10305612 3300009553 Bacteria 1597
55 Ga0105246_10261175 3300011119 Unclassified 1380
56 Ga0157380_10140910 3300014326 Unclassified 2072
57 Ga0207684_10728040 3300025910 Unclassified 842
58 Ga0207660_10863440 3300025917 Bacteria 738
59 Ga0207646_10120867 3300025922 Unclassified 2353
60 Ga0207646_10184411 3300025922 Unclassified 1885
61 Ga0207712_10383613 3300025961 Bacteria 1177
62 Ga0207708_10213796 3300026075 Unclassified 1542
63 Ga0209999_1013668 3300027543 Bacteria 1472
64 Ga0268265_10171973 3300028380 Bacteria 1853
65 Ga0265334_10014739 3300028573 Bacteria 3255
66 Ga0265338_10416558 3300028800 Unclassified 955
67 Ga0265320_10012994 3300031240 Bacteria 4808
68 Ga0265320_10046561 3300031240 Bacteria 2125
69 Ga0265340_10065465 3300031247 Bacteria 1730
70 Ga0316575_10108724 3300031665 Unclassified 1131
71 Ga0316576_10174728 3300031727 Bacteria 1621
72 Ga0307416_101140724 3300032002 Unclassified 885
73 Ga0316582_0234344 3300036647 Bacteria 1257
74 Ga0316584_0117618 3300036712 Bacteria 1988
75 Ga0316584_0246210 3300036712 Unclassified 1307
76 Ga0316584_0340062 3300036712 Unclassified 1079
77 Ga0451577_0005216 3300042876 Bacteria 13371
78 Ga0451577_0007784 3300042876 Bacteria 10500
79 Ga0451577_0202272 3300042876 Bacteria 1793
80 Ga0451577_0210220 3300042876 Bacteria 1757
81 Ga0451577_0295099 3300042876 Bacteria 1469
82 Ga0451577_0633550 3300042876 Bacteria 970
83 Ga0453683_0016878 3300044673 Bacteria 4706
84 Ga0453683_0104500 3300044673 Bacteria 1779
85 Ga0453683_0114273 3300044673 Unclassified 1698
86 Ga0453683_0363453 3300044673 Unclassified 930
87 Ga0453684_0000044 3300044712 Bacteria 585643
88 Ga0453684_0000640 3300044712 Bacteria 126342
89 Ga0453684_0000772 3300044712 Bacteria 110509
90 Ga0453684_0000827 3300044712 Bacteria 104649
91 Ga0453684_0008559 3300044712 Bacteria 18256
92 Ga0453684_0020666 3300044712 Bacteria 9907
93 Ga0453684_0030311 3300044712 Bacteria 7646
94 Ga0453684_0034556 3300044712 Bacteria 7013
95 Ga0453684_0042657 3300044712 Bacteria 6113
96 Ga0453684_0046341 3300044712 Bacteria 5782
97 Ga0453684_0046572 3300044712 Bacteria 5765
98 Ga0453684_0050867 3300044712 Bacteria 5442
99 Ga0453684_0065135 3300044712 Unclassified 4649
100 Ga0453684_0079109 3300044712 Unclassified 4111
101 Ga0453684_0081372 3300044712 Bacteria 4039
102 Ga0453684_0092950 3300044712 Bacteria 3717
103 Ga0453684_0100846 3300044712 Unclassified 3533
104 Ga0453684_0109787 3300044712 Unclassified 3354
105 Ga0453684_0122085 3300044712 Unclassified 3143
106 Ga0453684_0128947 3300044712 Bacteria 3038
107 Ga0453684_0264353 3300044712 Bacteria 1969
108 Ga0453684_0289581 3300044712 Bacteria 1865
109 Ga0453684_0327185 3300044712 Bacteria 1734
110 Ga0453684_0380834 3300044712 Bacteria 1584
111 Ga0453684_0404025 3300044712 Bacteria 1529
112 Ga0453684_0536048 3300044712 Bacteria 1291
113 Ga0453684_0575124 3300044712 Unclassified 1238
114 Ga0453684_0632415 3300044712 Unclassified 1169
115 Ga0453684_0669146 3300044712 Bacteria 1131
116 Ga0453684_0684444 3300044712 Bacteria 1116
117 Ga0453684_0837554 3300044712 Unclassified 989
118 Ga0453684_0919766 3300044712 Unclassified 935
119 Ga0453684_1280333 3300044712 Unclassified 766
120 Ga0451576_0001278 3300045051 Bacteria 43871
121 Ga0451576_0004396 3300045051 Bacteria 18345
122 Ga0451576_0096312 3300045051 Bacteria 3078
123 Ga0501036_0709635 3300049572 Bacteria 831
124 Ga0501040_0401668 3300049576 Bacteria 984
125 Ga0501042_0851459 3300049578 Bacteria 664
126 Ga0501046_0172401 3300049580 Bacteria 1623
127 Ga0501071_0180544 3300049587 Bacteria 1581
128 Ga0501074_0112710 3300049590 Bacteria 1946
129 Ga0501075_0295256 3300049591 Bacteria 1234
130 Ga0501076_0203650 3300049592 Bacteria 1616
131 Ga0501076_0214883 3300049592 Bacteria 1572
132 Ga0501207_104060 3300049654 Unclassified 573
133 Ga0501239_025760 3300049672 Unclassified 747
134 Ga0501045_0278542 3300049824 Bacteria 1245
135 Ga0501045_0358115 3300049824 Bacteria 1086
136 nmdc:mga05p37_119031_c1 3300050507 Unclassified 3245
137 nmdc:mga05p37_163_c1 3300050507 Bacteria 64430
138 nmdc:mga05p37_18731_c1 3300050507 Bacteria 8366
139 nmdc:mga05p37_439806_c1 3300050507 Bacteria 1513
140 nmdc:mga09592_100058_c1 3300050508 Bacteria 2482
141 nmdc:mga09592_367698_c1 3300050508 Unclassified 1244
142 nmdc:mga09592_3821_c1 3300050508 Bacteria 12132
143 nmdc:mga09592_559796_c1 3300050508 Bacteria 982
144 nmdc:mga09592_56991_c1 3300050508 Unclassified 3301
145 nmdc:mga0qj67_38679_c2 3300050509 Bacteria 3362
146 nmdc:mga0qj67_61895_c1 3300050509 Unclassified 2972
147 nmdc:mga06r32_13593_c1 3300050510 Bacteria 7379
148 nmdc:mga06r32_1394668_c1 3300050510 Bacteria 643
149 nmdc:mga06r32_568736_c1 3300050510 Bacteria 1106
150 nmdc:mga0n895_155356_c1 3300050512 Bacteria 2318
151 nmdc:mga0a205_127650_c1 3300050515 Bacteria 2443
152 nmdc:mga0a205_143700_c1 3300050515 Unclassified 2286
153 Ga0501084_0041989 3300054114 Bacteria 3825
154 Ga0501084_0073331 3300054114 Bacteria 2867
155 Ga0501082_0172543 3300060353 Bacteria 1880
156 Ga0530510_0375581 3300061734 Bacteria 1070
157 Ga0530510_0658916 3300061734 Bacteria 797
158 Ga0530510_0823422 3300061734 Bacteria 708

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_1280333 Ga0453684_1280333_264_749 157
2 3300009553 Ga0105249_10305612 Ga0105249_103056122 165
3 3300005440 Ga0070705_100282363 Ga0070705_1002823632 167
4 3300005471 Ga0070698_100047417 Ga0070698_1000474173 167
5 3300005518 Ga0070699_100044275 Ga0070699_1000442753 167
6 3300005844 Ga0068862_100131665 Ga0068862_1001316652 167
7 3300009148 Ga0105243_10418648 Ga0105243_104186481 167
8 3300025917 Ga0207660_10863440 Ga0207660_108634402 167
9 3300025922 Ga0207646_10184411 Ga0207646_101844112 167
10 3300044712 Ga0453684_0128947 Ga0453684_0128947_1086_1727 167
11 3300006846 Ga0075430_100444237 Ga0075430_1004442372 170
12 3300049654 Ga0501207_104060 Ga0501207_104060_12_527 170
13 3300006844 Ga0075428_100586623 Ga0075428_1005866232 171
14 3300006880 Ga0075429_100104495 Ga0075429_1001044952 171
15 3300009147 Ga0114129_10061505 Ga0114129_100615056 171
16 3300050508 nmdc:mga09592_56991_c1 nmdc:mga09592_56991_c1_1301_1885 171
17 3300044712 Ga0453684_0042657 Ga0453684_0042657_5310_5867 175
18 3300042876 Ga0451577_0202272 Ga0451577_0202272_256_798 180
19 3300044712 Ga0453684_0030311 Ga0453684_0030311_4607_5149 180
20 3300028800 Ga0265338_10416558 Ga0265338_104165581 181
21 3300031247 Ga0265340_10065465 Ga0265340_100654652 181
22 3300036647 Ga0316582_0234344 Ga0316582_0234344_633_1187 183
23 3300003203 JGI25406J46586_10079466 JGI25406J46586_100794661 184
24 3300005289 Ga0065704_10469248 Ga0065704_104692481 184
25 3300005471 Ga0070698_100019583 Ga0070698_1000195835 184
26 3300005985 Ga0081539_10025754 Ga0081539_100257543 184
27 3300009147 Ga0114129_11769137 Ga0114129_117691372 184
28 3300011119 Ga0105246_10261175 Ga0105246_102611752 184
29 3300025961 Ga0207712_10383613 Ga0207712_103836131 184
30 3300026075 Ga0207708_10213796 Ga0207708_102137962 184
31 3300028380 Ga0268265_10171973 Ga0268265_101719732 184
32 3300031240 Ga0265320_10046561 Ga0265320_100465614 184
33 3300042876 Ga0451577_0295099 Ga0451577_0295099_535_1089 184
34 3300044673 Ga0453683_0114273 Ga0453683_0114273_510_1064 184
35 3300044673 Ga0453683_0363453 Ga0453683_0363453_241_795 184
36 3300044712 Ga0453684_0000640 Ga0453684_0000640_27120_27674 184
37 3300044712 Ga0453684_0109787 Ga0453684_0109787_2350_2904 184
38 3300044712 Ga0453684_0264353 Ga0453684_0264353_385_939 184
39 3300044712 Ga0453684_0404025 Ga0453684_0404025_625_1179 184
40 3300044712 Ga0453684_0575124 Ga0453684_0575124_235_789 184
41 3300044712 Ga0453684_0837554 Ga0453684_0837554_385_945 184
42 3300045051 Ga0451576_0001278 Ga0451576_0001278_5608_6168 184
43 3300045051 Ga0451576_0004396 Ga0451576_0004396_14648_15202 184
44 3300050512 nmdc:mga0n895_155356_c1 nmdc:mga0n895_155356_c1_1094_1651 184
45 3300003203 JGI25406J46586_10007652 JGI25406J46586_100076524 185
46 3300005289 Ga0065704_10000630 Ga0065704_1000063015 185
47 3300005295 Ga0065707_10000939 Ga0065707_1000093913 185
48 3300005295 Ga0065707_10087849 Ga0065707_100878494 185
49 3300005295 Ga0065707_10148207 Ga0065707_101482072 185
50 3300005340 Ga0070689_100673384 Ga0070689_1006733842 185
51 3300005468 Ga0070707_100661697 Ga0070707_1006616972 185
52 3300005471 Ga0070698_100142245 Ga0070698_1001422452 185
53 3300005518 Ga0070699_100001469 Ga0070699_1000014695 185
54 3300005518 Ga0070699_100017893 Ga0070699_1000178932 185
55 3300005549 Ga0070704_100157479 Ga0070704_1001574793 185
56 3300005549 Ga0070704_100663145 Ga0070704_1006631452 185
57 3300005617 Ga0068859_100207121 Ga0068859_1002071212 185
58 3300006194 Ga0075427_10002379 Ga0075427_100023792 185
59 3300006844 Ga0075428_100045344 Ga0075428_1000453442 185
60 3300006844 Ga0075428_100048794 Ga0075428_1000487946 185
61 3300006844 Ga0075428_100073260 Ga0075428_1000732603 185
62 3300006846 Ga0075430_100055018 Ga0075430_1000550182 185
63 3300006847 Ga0075431_100015750 Ga0075431_10001575010 185
64 3300006847 Ga0075431_100317457 Ga0075431_1003174572 185
65 3300006847 Ga0075431_100404955 Ga0075431_1004049552 185
66 3300006847 Ga0075431_100783656 Ga0075431_1007836562 185
67 3300006852 Ga0075433_10064365 Ga0075433_100643653 185
68 3300006852 Ga0075433_10308471 Ga0075433_103084711 185
69 3300006880 Ga0075429_100004051 Ga0075429_1000040513 185
70 3300006880 Ga0075429_100125109 Ga0075429_1001251092 185
71 3300006880 Ga0075429_100185147 Ga0075429_1001851472 185
72 3300006880 Ga0075429_100880663 Ga0075429_1008806631 185
73 3300006931 Ga0097620_100207105 Ga0097620_1002071052 185
74 3300009147 Ga0114129_10001947 Ga0114129_1000194719 185
75 3300009147 Ga0114129_10008547 Ga0114129_1000854714 185
76 3300009147 Ga0114129_10011326 Ga0114129_1001132614 185
77 3300009147 Ga0114129_10057780 Ga0114129_100577806 185
78 3300009147 Ga0114129_10123675 Ga0114129_101236753 185
79 3300009147 Ga0114129_10287700 Ga0114129_102877002 185
80 3300009147 Ga0114129_10299551 Ga0114129_102995513 185
81 3300009147 Ga0114129_10775288 Ga0114129_107752881 185
82 3300009176 Ga0105242_10116282 Ga0105242_101162822 185
83 3300009553 Ga0105249_10303547 Ga0105249_103035472 185
84 3300014326 Ga0157380_10140910 Ga0157380_101409102 185
85 3300025910 Ga0207684_10728040 Ga0207684_107280402 185
86 3300025922 Ga0207646_10120867 Ga0207646_101208673 185
87 3300027543 Ga0209999_1013668 Ga0209999_10136682 185
88 3300028573 Ga0265334_10014739 Ga0265334_100147392 185
89 3300031240 Ga0265320_10012994 Ga0265320_100129943 185
90 3300031665 Ga0316575_10108724 Ga0316575_101087242 185
91 3300031727 Ga0316576_10174728 Ga0316576_101747282 185
92 3300032002 Ga0307416_101140724 Ga0307416_1011407241 185
93 3300036712 Ga0316584_0117618 Ga0316584_0117618_326_886 185
94 3300036712 Ga0316584_0246210 Ga0316584_0246210_68_628 185
95 3300036712 Ga0316584_0340062 Ga0316584_0340062_215_781 185
96 3300042876 Ga0451577_0005216 Ga0451577_0005216_3464_4021 185
97 3300042876 Ga0451577_0007784 Ga0451577_0007784_3848_4405 185
98 3300042876 Ga0451577_0210220 Ga0451577_0210220_173_739 185
99 3300042876 Ga0451577_0633550 Ga0451577_0633550_302_874 185
100 3300044673 Ga0453683_0016878 Ga0453683_0016878_690_1247 185
101 3300044673 Ga0453683_0104500 Ga0453683_0104500_554_1114 185
102 3300044712 Ga0453684_0000044 Ga0453684_0000044_507460_508017 185
103 3300044712 Ga0453684_0000772 Ga0453684_0000772_4505_5074 185
104 3300044712 Ga0453684_0000827 Ga0453684_0000827_9579_10193 185
105 3300044712 Ga0453684_0008559 Ga0453684_0008559_4318_4875 185
106 3300044712 Ga0453684_0020666 Ga0453684_0020666_5692_6249 185
107 3300044712 Ga0453684_0034556 Ga0453684_0034556_6070_6636 185
108 3300044712 Ga0453684_0046341 Ga0453684_0046341_1753_2310 185
109 3300044712 Ga0453684_0046572 Ga0453684_0046572_1600_2157 185
110 3300044712 Ga0453684_0050867 Ga0453684_0050867_4249_4806 185
111 3300044712 Ga0453684_0065135 Ga0453684_0065135_3509_4081 185
112 3300044712 Ga0453684_0079109 Ga0453684_0079109_1038_1607 185
113 3300044712 Ga0453684_0081372 Ga0453684_0081372_3001_3567 185
114 3300044712 Ga0453684_0092950 Ga0453684_0092950_714_1274 185
115 3300044712 Ga0453684_0100846 Ga0453684_0100846_148_705 185
116 3300044712 Ga0453684_0122085 Ga0453684_0122085_1388_1945 185
117 3300044712 Ga0453684_0289581 Ga0453684_0289581_184_750 185
118 3300044712 Ga0453684_0327185 Ga0453684_0327185_601_1182 185
119 3300044712 Ga0453684_0380834 Ga0453684_0380834_735_1310 185
120 3300044712 Ga0453684_0536048 Ga0453684_0536048_335_895 185
121 3300044712 Ga0453684_0632415 Ga0453684_0632415_109_675 185
122 3300044712 Ga0453684_0669146 Ga0453684_0669146_493_1050 185
123 3300044712 Ga0453684_0684444 Ga0453684_0684444_71_634 185
124 3300044712 Ga0453684_0919766 Ga0453684_0919766_339_896 185
125 3300045051 Ga0451576_0096312 Ga0451576_0096312_608_1165 185
126 3300049572 Ga0501036_0709635 Ga0501036_0709635_68_628 185
127 3300049576 Ga0501040_0401668 Ga0501040_0401668_140_700 185
128 3300049578 Ga0501042_0851459 Ga0501042_0851459_40_600 185
129 3300049580 Ga0501046_0172401 Ga0501046_0172401_194_772 185
130 3300049587 Ga0501071_0180544 Ga0501071_0180544_486_1064 185
131 3300049590 Ga0501074_0112710 Ga0501074_0112710_1353_1931 185
132 3300049591 Ga0501075_0295256 Ga0501075_0295256_604_1182 185
133 3300049592 Ga0501076_0203650 Ga0501076_0203650_800_1378 185
134 3300049592 Ga0501076_0214883 Ga0501076_0214883_775_1335 185
135 3300049672 Ga0501239_025760 Ga0501239_025760_35_595 185
136 3300049824 Ga0501045_0278542 Ga0501045_0278542_179_757 185
137 3300049824 Ga0501045_0358115 Ga0501045_0358115_305_865 185
138 3300050507 nmdc:mga05p37_119031_c1 nmdc:mga05p37_119031_c1_53_673 185
139 3300050507 nmdc:mga05p37_163_c1 nmdc:mga05p37_163_c1_17201_17761 185
140 3300050507 nmdc:mga05p37_18731_c1 nmdc:mga05p37_18731_c1_3444_4004 185
141 3300050507 nmdc:mga05p37_439806_c1 nmdc:mga05p37_439806_c1_107_664 185
142 3300050508 nmdc:mga09592_100058_c1 nmdc:mga09592_100058_c1_571_1131 185
143 3300050508 nmdc:mga09592_367698_c1 nmdc:mga09592_367698_c1_501_1073 185
144 3300050508 nmdc:mga09592_3821_c1 nmdc:mga09592_3821_c1_2986_3546 185
145 3300050508 nmdc:mga09592_559796_c1 nmdc:mga09592_559796_c1_54_623 185
146 3300050509 nmdc:mga0qj67_38679_c2 nmdc:mga0qj67_38679_c2_930_1490 185
147 3300050509 nmdc:mga0qj67_61895_c1 nmdc:mga0qj67_61895_c1_1952_2521 185
148 3300050510 nmdc:mga06r32_13593_c1 nmdc:mga06r32_13593_c1_1778_2338 185
149 3300050510 nmdc:mga06r32_1394668_c1 nmdc:mga06r32_1394668_c1_23_580 185
150 3300050510 nmdc:mga06r32_568736_c1 nmdc:mga06r32_568736_c1_138_707 185
151 3300050515 nmdc:mga0a205_127650_c1 nmdc:mga0a205_127650_c1_1720_2340 185
152 3300050515 nmdc:mga0a205_143700_c1 nmdc:mga0a205_143700_c1_890_1450 185
153 3300054114 Ga0501084_0041989 Ga0501084_0041989_1487_2065 185
154 3300054114 Ga0501084_0073331 Ga0501084_0073331_2008_2568 185
155 3300060353 Ga0501082_0172543 Ga0501082_0172543_502_1080 185
156 3300061734 Ga0530510_0375581 Ga0530510_0375581_464_1024 185
157 3300061734 Ga0530510_0658916 Ga0530510_0658916_202_762 185
158 3300061734 Ga0530510_0823422 Ga0530510_0823422_18_596 185

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03602

Cons_hypoth95

Conserved hypothetical protein 95

27

208

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2esr-assembly1.cif.gz_B conserved hypothetical protein- streptococcus pyogenes 0.8995 30 181
4lwo-assembly1.cif.gz_B crystal structure of prmt6 0.884 42 109
2fpo-assembly4.cif.gz_D putative methyltransferase yhhf from escherichia coli. 0.8787 5 184
2fpo-assembly1.cif.gz_A putative methyltransferase yhhf from escherichia coli. 0.8729 5 185
2fpo-assembly5.cif.gz_E putative methyltransferase yhhf from escherichia coli. 0.8688 5 185
ID Description Score Start End Superfamily
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.929 45 106 3.40.50.150
af_Q2FZF6_1_156_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9133 27 185 3.40.50.150
af_Q2FZF6_1_156_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9077 27 185 3.40.50.150
af_A0A5K1K930_343_529_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8949 11 181 3.40.50.150
af_P0ADX9_1_198_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.891 5 184 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A399Z7B9-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD 0.9945 30 185 GO:0008168
GO:0031167
AF-A0A399Z7B9-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD 0.9758 30 185 GO:0008168
GO:0031167
AF-A0A537LN40-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD (EC 2.1.1.171) 0.9484 29 185 GO:0003676
GO:0052913
AF-A0A3A0G9P0-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD 0.9447 3 184 GO:0008168
GO:0031167
AF-E0RRW8-F1-model_v4 Methyltransferase 0.9443 11 185 GO:0003676
GO:0008168
GO:0031167

Feature Viewer

pLDDT pTM Quality
89.15 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map