F229507

General Info

Members Datasets Scaffolds Average Seq Length
158 99 316 234

Family's Representative Sequence

Representative Sequence 3300009036|Ga0105244_10018573|Ga0105244_100185732
Length 243
Sequence MSGGRDGRLGVGIIGAGRVGPVIGAALAGAGHALTGITSGSDDDRVEAILPGLPVLSSEEVVRRSELVVVAVPHDQLPGLVAGLADLGAWQPGQLVLHTDPAYGVEVLTPALQRGAIPLAIHPAIVFTGASSIDLRQLAQAYAAVTAPAPVLPIAQALAVELGCEPVVIAEADRPAYAEAVATATQFSRSIVRQSAELLAGVGVENTGAYLSALVRSSVDQALVEGTGPTGADGLPPDATIDG

Samples

Sample ID Description Type Environment
1 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
8 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
9 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
10 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
11 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
12 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
13 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
14 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
15 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
16 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
17 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
18 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
19 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
20 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
25 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
26 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
27 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
28 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
29 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
30 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
31 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
32 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
33 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
34 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
35 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
36 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
37 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
38 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
39 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
40 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
41 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
42 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
43 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
44 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
45 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
46 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
47 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
48 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
49 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
50 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
51 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
52 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
53 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
54 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
55 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
56 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
57 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
58 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
59 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
60 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
61 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
62 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
63 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
64 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
65 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
66 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
67 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
68 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
69 2643221566 Microbacterium sp. Root166 Isolate Unclassified
70 2643221575 Microbacterium sp. Root61 Isolate Unclassified
71 2643221597 Microbacterium sp. Root180 Isolate Unclassified
72 2643221630 Microbacterium sp. Root322 Isolate Unclassified
73 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
74 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
75 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
76 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
77 2773857759 Microbacterium sp. 1294 Isolate Unclassified
78 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
79 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
80 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
81 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
82 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
83 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
84 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
85 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
86 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
87 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
88 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
89 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
90 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
91 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
92 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
93 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
94 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
95 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
96 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
97 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
98 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
99 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 77.85
Metatranscriptomes 1.27
Isolates 20.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.86
Nodule 0
Rhizoplane 6.33
Rhizosphere 37.97
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105244_10018573 3300009036 Bacteria 3898
2 JGI24740J21852_10003699 3300001979 Bacteria 6663
3 JGI25154J39366_1001535 3300002738 Bacteria 8020
4 rootH2_10106196 3300003320 Bacteria 7344
5 Ga0006562J51391_1146641 3300003578 Bacteria 6290
6 Ga0006562J51391_1146643 3300003578 Bacteria 3060
7 Ga0070659_100548955 3300005366 Bacteria 989
8 Ga0075368_10004720 3300006042 Bacteria 4637
9 Ga0075363_100006583 3300006048 Bacteria 5291
10 Ga0075364_10033139 3300006051 Bacteria 3323
11 Ga0075364_10043121 3300006051 Bacteria 2932
12 Ga0075364_10083141 3300006051 Bacteria 2119
13 Ga0075367_10000845 3300006178 Bacteria 12182
14 Ga0075369_10006547 3300006186 Bacteria 4407
15 Ga0075370_10003669 3300006353 Bacteria 7347
16 Ga0105243_10001512 3300009148 Bacteria 20307
17 Ga0157371_10046364 3300013102 Bacteria 3091
18 Ga0157370_10072883 3300013104 Bacteria 3240
19 Ga0171462_1005 3300013250 Bacteria 598379
20 Ga0157375_10189478 3300013308 Bacteria 2211
21 Ga0157380_10176913 3300014326 Bacteria 1871
22 Ga0209646_1000041 3300025246 Bacteria 346024
23 Ga0207655_1002108 3300025728 Bacteria 16634
24 Ga0207709_10002516 3300025935 Bacteria 11433
25 Ga0207674_10772565 3300026116 Bacteria 927
26 Ga0268266_10256609 3300028379 Bacteria 1619
27 Ga0307410_10540038 3300031852 Bacteria 965
28 Ga0307406_10000016 3300031901 Bacteria 106175
29 Ga0307406_10000792 3300031901 Bacteria 17695
30 Ga0307406_10001063 3300031901 Bacteria 15283
31 Ga0307406_10023127 3300031901 Bacteria 3696
32 Ga0307406_10197521 3300031901 Bacteria 1478
33 Ga0307406_10199317 3300031901 Bacteria 1472
34 Ga0307412_10543292 3300031911 Bacteria 975
35 Ga0307414_10036092 3300032004 Bacteria 3296
36 Ga0307414_10436087 3300032004 Bacteria 1146
37 Ga0307414_10549886 3300032004 Bacteria 1029
38 Ga0307415_100079118 3300032126 Bacteria 2341
39 Ga0395901_0166830 3300038443 Bacteria 2311
40 Ga0439465_0058402 3300041413 Bacteria 1275
41 Ga0451853_2362414 3300041512 Bacteria 1490
42 Ga0466972_0125781 3300044658 Bacteria 1208
43 Ga0466965_0056481 3300044683 Bacteria 1955
44 Ga0466965_0133527 3300044683 Bacteria 1288
45 Ga0466968_0007943 3300044735 Bacteria 4052
46 Ga0466970_0049109 3300044765 Bacteria 2251
47 Ga0466970_0136833 3300044765 Bacteria 1348
48 Ga0466957_0413474 3300044842 Bacteria 924
49 Ga0466960_0075532 3300044901 Bacteria 1686
50 Ga0466960_0166769 3300044901 Bacteria 1186
51 Ga0466958_0090731 3300045836 Bacteria 1891
52 Ga0466967_0227778 3300045976 Bacteria 1774
53 Ga0495627_000238 3300046453 Bacteria 57919
54 Ga0495620_0070721 3300046515 Bacteria 1429
55 Ga0495654_0087238 3300046530 Bacteria 1453
56 Ga0496104_0265668 3300048907 Bacteria 1628
57 Ga0496104_0285623 3300048907 Bacteria 1563
58 Ga0496105_0310713 3300048908 Bacteria 1265
59 Ga0496105_0434003 3300048908 Bacteria 1039
60 Ga0496108_0735049 3300048911 Bacteria 854
61 Ga0496113_0289427 3300048916 Bacteria 1310
62 Ga0496114_0147312 3300048917 Bacteria 2041
63 Ga0496114_0405301 3300048917 Bacteria 1207
64 Ga0496114_0520072 3300048917 Bacteria 1052
65 Ga0496114_1011955 3300048917 Bacteria 714
66 Ga0496116_0054270 3300048919 Bacteria 2641
67 Ga0496117_0000070 3300048920 Bacteria 245027
68 Ga0496117_0000196 3300048920 Bacteria 119243
69 Ga0496117_0005093 3300048920 Bacteria 14054
70 Ga0496117_0009057 3300048920 Bacteria 9357
71 Ga0496117_0098537 3300048920 Bacteria 1858
72 Ga0496118_0010545 3300048921 Bacteria 9137
73 Ga0496118_0015650 3300048921 Bacteria 7006
74 Ga0496119_0000888 3300048922 Bacteria 39161
75 Ga0496119_0001252 3300048922 Bacteria 31554
76 Ga0496119_0004716 3300048922 Bacteria 13403
77 Ga0496119_0007300 3300048922 Bacteria 9999
78 Ga0496120_0000462 3300048923 Bacteria 64059
79 Ga0496120_0002073 3300048923 Bacteria 21551
80 Ga0496120_0002836 3300048923 Bacteria 16700
81 Ga0496120_0022021 3300048923 Bacteria 4014
82 Ga0496122_0000105 3300048925 Bacteria 194509
83 Ga0496122_0000111 3300048925 Bacteria 189920
84 Ga0496122_0004299 3300048925 Bacteria 17852
85 Ga0496122_0039571 3300048925 Bacteria 3758
86 Ga0496122_0063478 3300048925 Bacteria 2695
87 Ga0496122_0117502 3300048925 Bacteria 1726
88 Ga0496122_0182426 3300048925 Bacteria 1250
89 Ga0496122_0243063 3300048925 Bacteria 1013
90 Ga0496122_0321743 3300048925 Bacteria 822
91 Ga0496123_0000006 3300048926 Bacteria 647258
92 Ga0496123_0000075 3300048926 Bacteria 194499
93 Ga0496123_0019523 3300048926 Bacteria 5340
94 Ga0496123_0032912 3300048926 Bacteria 3741
95 Ga0496124_0007313 3300048927 Bacteria 11774
96 Ga0496124_0023333 3300048927 Bacteria 5649
97 Ga0496124_0028271 3300048927 Bacteria 5019
98 Ga0496124_0186226 3300048927 Bacteria 1593
99 Ga0496124_0202132 3300048927 Bacteria 1510
100 Ga0496124_0401462 3300048927 Bacteria 951
101 Ga0496125_0000550 3300048928 Bacteria 64700
102 Ga0496125_0008507 3300048928 Bacteria 10732
103 Ga0496125_0012337 3300048928 Bacteria 8490
104 Ga0496125_0014913 3300048928 Bacteria 7547
105 Ga0496125_0019335 3300048928 Bacteria 6429
106 Ga0496125_0066687 3300048928 Bacteria 2842
107 Ga0496126_0012236 3300048929 Bacteria 8802
108 Ga0496126_0019411 3300048929 Bacteria 6695
109 Ga0496126_0030138 3300048929 Bacteria 5144
110 Ga0496126_0181762 3300048929 Bacteria 1786
111 Ga0496126_0319431 3300048929 Bacteria 1277
112 Ga0496126_0860443 3300048929 Bacteria 691
113 Ga0501034_0631043 3300049571 Bacteria 975
114 Ga0501037_0211969 3300049573 Bacteria 1366
115 Ga0501038_0047573 3300049574 Bacteria 3715
116 Ga0501038_0248783 3300049574 Bacteria 1409
117 Ga0501038_0341636 3300049574 Bacteria 1167
118 Ga0501043_0284935 3300049579 Bacteria 1266
119 Ga0501070_0003674 3300049586 Bacteria 13262
120 nmdc:mga00v17_21557_c1 3300050491 Bacteria 3705
121 nmdc:mga00v17_4253_c1 3300050491 Bacteria 7433
122 nmdc:mga00v17_52729_c1 3300050491 Bacteria 2476
123 nmdc:mga0yw44_3374_c1 3300050492 Bacteria 7085
124 nmdc:mga06z11_1302_c1 3300050494 Bacteria 9228
125 nmdc:mga07m45_42178_c1 3300050496 Bacteria 2557
126 2588107778 2585428157 Bacteria 3018951
127 2643734572 2643221542 Bacteria 3563959
128 2643847549 2643221566 Bacteria 3460379
129 2643887291 2643221575 Bacteria 4022601
130 2643997572 2643221597 Bacteria 3347721
131 2644172698 2643221630 Bacteria 3601215
132 2644678934 2643221724 Bacteria 3593515
133 2730228446 2728369380 Bacteria 3620317
134 2747954680 2747842429 Bacteria 3914386
135 2758225003 2757320536 Bacteria 3629334
136 2774382702 2773857759 Bacteria 2963774
137 2774400987 2773857763 Bacteria 4180068
138 2808629694 2808606306 Bacteria 3608896
139 2808884605 2808606368 Bacteria 3174172
140 2809225570 2808606447 Bacteria 3572005
141 2821268591 2821268502 Bacteria 3750023
142 2833713251 2833709550 Bacteria 4008291
143 2852635579 2852632344 Bacteria 3463163
144 2852648287 2852646457 Bacteria 3408613
145 2852667198 2852663356 Bacteria 4090475
146 2857727041 2857723135 Bacteria 4217853
147 2870628271 2870628048 Bacteria 3696012
148 2945970342 2945968032 Bacteria 4111363
149 2946035135 2946033335 Bacteria 3835514
150 2946042739 2946041624 Bacteria 4191385
151 2946082320 2946080515 Bacteria 4310960
152 2974294992 2974294766 Bacteria 3767688
153 2974325206 2974324384 Bacteria 3750535
154 2977252889 2977251589 Bacteria 2952848
155 2977265368 2977264416 Bacteria 3750737
156 8004183288 8004182704 Bacteria 3391155
157 8004215117 8004212874 Bacteria 2861420
158 8045831140 8045830549 Bacteria 4444727
159 Ga0105244_10018573
160 JGI24740J21852_10003699
161 JGI25154J39366_1001535
162 rootH2_10106196
163 Ga0006562J51391_1146641
164 Ga0006562J51391_1146643
165 Ga0070659_100548955
166 Ga0075368_10004720
167 Ga0075363_100006583
168 Ga0075364_10033139
169 Ga0075364_10043121
170 Ga0075364_10083141
171 Ga0075367_10000845
172 Ga0075369_10006547
173 Ga0075370_10003669
174 Ga0105243_10001512
175 Ga0157371_10046364
176 Ga0157370_10072883
177 Ga0171462_1005
178 Ga0157375_10189478
179 Ga0157380_10176913
180 Ga0209646_1000041
181 Ga0207655_1002108
182 Ga0207709_10002516
183 Ga0207674_10772565
184 Ga0268266_10256609
185 Ga0307410_10540038
186 Ga0307406_10000016
187 Ga0307406_10000792
188 Ga0307406_10001063
189 Ga0307406_10023127
190 Ga0307406_10197521
191 Ga0307406_10199317
192 Ga0307412_10543292
193 Ga0307414_10036092
194 Ga0307414_10436087
195 Ga0307414_10549886
196 Ga0307415_100079118
197 Ga0395901_0166830
198 Ga0439465_0058402
199 Ga0451853_2362414
200 Ga0466972_0125781
201 Ga0466965_0056481
202 Ga0466965_0133527
203 Ga0466968_0007943
204 Ga0466970_0049109
205 Ga0466970_0136833
206 Ga0466957_0413474
207 Ga0466960_0075532
208 Ga0466960_0166769
209 Ga0466958_0090731
210 Ga0466967_0227778
211 Ga0495627_000238
212 Ga0495620_0070721
213 Ga0495654_0087238
214 Ga0496104_0265668
215 Ga0496104_0285623
216 Ga0496105_0310713
217 Ga0496105_0434003
218 Ga0496108_0735049
219 Ga0496113_0289427
220 Ga0496114_0147312
221 Ga0496114_0405301
222 Ga0496114_0520072
223 Ga0496114_1011955
224 Ga0496116_0054270
225 Ga0496117_0000070
226 Ga0496117_0000196
227 Ga0496117_0005093
228 Ga0496117_0009057
229 Ga0496117_0098537
230 Ga0496118_0010545
231 Ga0496118_0015650
232 Ga0496119_0000888
233 Ga0496119_0001252
234 Ga0496119_0004716
235 Ga0496119_0007300
236 Ga0496120_0000462
237 Ga0496120_0002073
238 Ga0496120_0002836
239 Ga0496120_0022021
240 Ga0496122_0000105
241 Ga0496122_0000111
242 Ga0496122_0004299
243 Ga0496122_0039571
244 Ga0496122_0063478
245 Ga0496122_0117502
246 Ga0496122_0182426
247 Ga0496122_0243063
248 Ga0496122_0321743
249 Ga0496123_0000006
250 Ga0496123_0000075
251 Ga0496123_0019523
252 Ga0496123_0032912
253 Ga0496124_0007313
254 Ga0496124_0023333
255 Ga0496124_0028271
256 Ga0496124_0186226
257 Ga0496124_0202132
258 Ga0496124_0401462
259 Ga0496125_0000550
260 Ga0496125_0008507
261 Ga0496125_0012337
262 Ga0496125_0014913
263 Ga0496125_0019335
264 Ga0496125_0066687
265 Ga0496126_0012236
266 Ga0496126_0019411
267 Ga0496126_0030138
268 Ga0496126_0181762
269 Ga0496126_0319431
270 Ga0496126_0860443
271 Ga0501034_0631043
272 Ga0501037_0211969
273 Ga0501038_0047573
274 Ga0501038_0248783
275 Ga0501038_0341636
276 Ga0501043_0284935
277 Ga0501070_0003674
278 nmdc:mga00v17_21557_c1
279 nmdc:mga00v17_4253_c1
280 nmdc:mga00v17_52729_c1
281 nmdc:mga0yw44_3374_c1
282 nmdc:mga06z11_1302_c1
283 nmdc:mga07m45_42178_c1
284 2588107778
285 2643734572
286 2643847549
287 2643887291
288 2643997572
289 2644172698
290 2644678934
291 2730228446
292 2747954680
293 2758225003
294 2774382702
295 2774400987
296 2808629694
297 2808884605
298 2809225570
299 2821268591
300 2833713251
301 2852635579
302 2852648287
303 2852667198
304 2857727041
305 2870628271
306 2945970342
307 2946035135
308 2946042739
309 2946082320
310 2974294992
311 2974325206
312 2977252889
313 2977265368
314 8004183288
315 8004215117
316 8045831140

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10727

Rossmann-like

Rossmann-like domain

1

123

0.96

PF10728

DUF2520

Domain of unknown function (DUF2520)

141

232

0.95

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

10

97

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wpu-assembly1.cif.gz_A structure of s-allyl-l-cysteine s-oxygenase from allium sativum 0.8854 5 36
1f8s-assembly1.cif.gz_B crystal structure of l-amino acid oxidase from calloselasma rhodostoma, complexed with three molecules of o-aminobenzoate. 0.8573 4 36
3kve-assembly1.cif.gz_D structure of native l-amino acid oxidase from vipera ammodytes ammodytes: stabilization of the quaternary structure by divalent ions and structural changes in the dynamic active site 0.8472 4 35
2bi8-assembly1.cif.gz_A udp-galactopyranose mutase from klebsiella pneumoniae with reduced fad 0.8439 5 36
3int-assembly3.cif.gz_B structure of udp-galactopyranose mutase bound to udp-galactose (reduced) 0.8439 5 36
ID Description Score Start End Superfamily
af_O06279_7_172_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9674 3 164 3.40.50.720
af_O06279_7_172_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9391 3 164 3.40.50.720
af_A0A1D6HR89_2_270_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8624 4 36 3.50.50.60
3rhaA00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8468 6 36 3.50.50.60
af_I1MWN9_30_410_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8449 8 37 3.50.50.60
ID Description Score Start End GO Terms
AF-W1VIQ0-F1-model_v4 NADP oxidoreductase coenzyme F420-dependent family protein 0.9835 1 150
AF-A0A519GWI9-F1-model_v4 DUF2520 domain-containing protein 0.9831 1 160
AF-A0A519GWI9-F1-model_v4 DUF2520 domain-containing protein 0.977 1 160
AF-A0A855HG21-F1-model_v4 deleted 0.9693 1 211
AF-A0A5B9G1W5-F1-model_v4 DUF2520 domain-containing protein 0.968 3 222

Map