F228537

General Info

Members Datasets Scaffolds Average Seq Length
157 117 314 289

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2954380949|2954381786
Length 315
Sequence RRGALTLVSMTSDSDSRALGAFLKARRAQLTPGECGLPERDSARKVAGLRREEVAQLAAISVDYYTRLEQGRVRASVPVLTTLARALRLDDDQQQYLYELAGRSDARPRRRRPAQRLRPAMRRLLDQLTETPALVLGNRLDILAWNPAAAALYTDFAALPAHRRNYLRLVFTHPVVRQLHQDWAHDAREAVAALRMEAAAAPDDPDLAQLVGELSLQDPDFRTWWAEHRVNSASYGTKHYRHPMVGDLTLDCDTWAAPDGSGQRLMILTAEPGTPSYDALRILTSWGTGRDDHLGTATSLPGVHPNRRRSGTSRE

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
11 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
12 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
13 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
14 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
15 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
19 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
20 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
21 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
22 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
23 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
24 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
25 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
26 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
27 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
28 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
29 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
30 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
31 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
32 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
33 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
34 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
35 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
36 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
37 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
38 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
39 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
40 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
41 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
42 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
43 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
44 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
45 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
46 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
47 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
48 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
49 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
50 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
51 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
52 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
53 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
54 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
55 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
56 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
57 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
58 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
59 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
60 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
61 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
62 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
63 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
64 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
65 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
66 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
67 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
68 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
69 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
70 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
74 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
78 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
79 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
80 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
81 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
82 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
83 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
84 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
85 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
86 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
87 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
88 2671180195 Frankia sp. CcI49 Isolate Nodule
89 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
90 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
91 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
92 2773857922 Frankia sp. CcI49 Isolate Nodule
93 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
94 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
95 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
96 2808606394 Promicromonospora sp. C35 Isolate Unclassified
97 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
98 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
99 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
100 2891562705 Microbispora tritici MT50 Isolate Unclassified
101 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
102 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
103 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
104 2928153084 Leifsonia sp. 563 Isolate Unclassified
105 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
106 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
107 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
108 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
109 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
110 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
111 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
112 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
113 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
114 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
115 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
116 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
117 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.71
Metatranscriptomes 1.91
Isolates 20.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.82
Nodule 1.91
Rhizoplane 1.27
Rhizosphere 74.52
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10177728 3300003320 Bacteria 3333
2 rootL2_10061073 3300003322 Bacteria 2211
3 rootL2_10160070 3300003322 Bacteria 1781
4 rootH1_10183008 3300003323 Bacteria 2534
5 Ga0006562J51391_1121065 3300003578 Bacteria 6059
6 Ga0006562J51391_1121066 3300003578 Bacteria 6000
7 Ga0068868_100367197 3300005338 Bacteria 1236
8 Ga0070709_10052589 3300005434 Bacteria 2561
9 Ga0070714_100046819 3300005435 Bacteria 3671
10 Ga0070713_100050710 3300005436 Bacteria 3429
11 Ga0070713_100099583 3300005436 Bacteria 2515
12 Ga0070663_100007413 3300005455 Bacteria 6675
13 Ga0070717_10422099 3300006028 Bacteria 1200
14 Ga0075363_100176376 3300006048 Bacteria 1215
15 Ga0075370_10060663 3300006353 Bacteria 2155
16 Ga0157372_10085868 3300013307 Bacteria 3570
17 Ga0182007_10005523 3300015262 Bacteria 5540
18 Ga0207700_10032347 3300025928 Bacteria 3730
19 Ga0207700_10129277 3300025928 Bacteria 2060
20 Ga0207664_10145115 3300025929 Bacteria 2012
21 Ga0207678_10000540 3300026067 Bacteria 34528
22 Ga0307515_10050686 3300028794 Bacteria 6210
23 Ga0307511_10105473 3300030521 Bacteria 1824
24 Ga0307513_10010349 3300031456 Bacteria 11698
25 Ga0307513_10018057 3300031456 Bacteria 8443
26 Ga0307513_10022767 3300031456 Bacteria 7352
27 Ga0307509_10024366 3300031507 Bacteria 6777
28 Ga0307514_10020142 3300031649 Bacteria 5447
29 Ga0307516_10024242 3300031730 Bacteria 6199
30 Ga0372808_007939 3300036459 Bacteria 1461
31 Ga0373925_0000053 3300037068 Bacteria 125353
32 Ga0395898_0001558 3300037466 Bacteria 31442
33 Ga0439448_0021985 3300042005 Bacteria 1979
34 Ga0450903_002650 3300042138 Bacteria 3152
35 Ga0466969_0041700 3300044656 Bacteria 2295
36 Ga0466972_0007630 3300044658 Bacteria 5429
37 Ga0466972_0009109 3300044658 Bacteria 4984
38 Ga0466972_0011902 3300044658 Bacteria 4371
39 Ga0466965_0049414 3300044683 Bacteria 2085
40 Ga0466966_0009155 3300044684 Bacteria 6557
41 Ga0466966_0043397 3300044684 Bacteria 2882
42 Ga0466961_0015879 3300044693 Bacteria 4832
43 Ga0466961_0076636 3300044693 Bacteria 2119
44 Ga0466961_0087921 3300044693 Bacteria 1963
45 Ga0466968_0043239 3300044735 Bacteria 1907
46 Ga0466960_0041090 3300044901 Bacteria 2190
47 Ga0466960_0060222 3300044901 Bacteria 1860
48 Ga0466959_0066762 3300045049 Bacteria 2609
49 Ga0466967_0081356 3300045976 Bacteria 2925
50 Ga0495627_003252 3300046453 Bacteria 7290
51 Ga0495592_0006975 3300046454 Bacteria 8440
52 Ga0495592_0015372 3300046454 Bacteria 5807
53 Ga0495592_0139775 3300046454 Bacteria 1685
54 Ga0495603_0050248 3300046455 Bacteria 2480
55 Ga0495603_0051095 3300046455 Bacteria 2457
56 Ga0495603_0260464 3300046455 Bacteria 998
57 Ga0495603_0266751 3300046455 Bacteria 985
58 Ga0495629_0005116 3300046459 Bacteria 9804
59 Ga0495629_0032237 3300046459 Bacteria 3710
60 Ga0495651_0002236 3300046462 Bacteria 14952
61 Ga0495651_0063698 3300046462 Bacteria 2818
62 Ga0495664_0123139 3300046477 Bacteria 1568
63 Ga0495664_0271886 3300046477 Bacteria 1024
64 Ga0495585_0036799 3300046492 Bacteria 2758
65 Ga0495618_0046029 3300046514 Bacteria 2753
66 Ga0495628_0015202 3300046516 Bacteria 6430
67 Ga0495628_0030892 3300046516 Bacteria 4335
68 Ga0495628_0204849 3300046516 Bacteria 1485
69 Ga0495666_0171637 3300046526 Bacteria 1003
70 Ga0495652_0027101 3300046529 Bacteria 5051
71 Ga0495652_0078245 3300046529 Bacteria 2738
72 Ga0495652_0350796 3300046529 Bacteria 1057
73 Ga0495640_0000407 3300046533 Bacteria 30987
74 Ga0495640_0007668 3300046533 Bacteria 8486
75 Ga0495640_0167055 3300046533 Bacteria 1407
76 Ga0495645_0010511 3300046543 Bacteria 6491
77 Ga0495645_0019529 3300046543 Bacteria 4878
78 Ga0495634_0024080 3300046642 Bacteria 4275
79 Ga0495634_0062037 3300046642 Bacteria 2483
80 Ga0495657_0029779 3300046675 Bacteria 3828
81 Ga0495657_0035164 3300046675 Bacteria 3474
82 Ga0495657_0055179 3300046675 Bacteria 2652
83 Ga0495623_0026013 3300046679 Bacteria 3769
84 Ga0495646_0070959 3300046680 Bacteria 2050
85 Ga0495613_0000524 3300046689 Bacteria 32032
86 Ga0495613_0035942 3300046689 Bacteria 3674
87 Ga0495613_0093725 3300046689 Bacteria 2173
88 Ga0495600_0001337 3300046809 Bacteria 13585
89 Ga0495600_0068433 3300046809 Bacteria 2320
90 Ga0495581_0051692 3300047315 Bacteria 2373
91 Ga0495581_0087396 3300047315 Bacteria 1807
92 Ga0495604_0014304 3300047317 Bacteria 6326
93 Ga0495604_0082865 3300047317 Bacteria 2397
94 Ga0495674_0027687 3300047319 Bacteria 5176
95 Ga0495676_0002231 3300047321 Bacteria 17195
96 Ga0495687_019905 3300047443 Bacteria 3281
97 Ga0495675_0114620 3300047444 Bacteria 1681
98 Ga0495685_078011 3300047447 Bacteria 1105
99 Ga0496114_0566250 3300048917 Bacteria 1003
100 Ga0496117_0006287 3300048920 Bacteria 12091
101 Ga0496119_0142483 3300048922 Bacteria 1293
102 Ga0496126_0007305 3300048929 Bacteria 12135
103 Ga0501031_0013315 3300049568 Bacteria 5368
104 Ga0501033_0201975 3300049570 Bacteria 1419
105 Ga0501033_0308188 3300049570 Bacteria 1114
106 Ga0501034_0153066 3300049571 Bacteria 2281
107 Ga0501036_0368812 3300049572 Bacteria 1198
108 Ga0501037_0103097 3300049573 Bacteria 2058
109 Ga0501038_0001543 3300049574 Bacteria 21259
110 Ga0501039_0577336 3300049575 Bacteria 882
111 Ga0501043_0217264 3300049579 Bacteria 1480
112 Ga0501047_0090557 3300049581 Bacteria 2936
113 Ga0501047_0122691 3300049581 Bacteria 2479
114 Ga0501069_0317693 3300049585 Bacteria 915
115 Ga0501080_0170741 3300049742 Bacteria 2006
116 Ga0501044_0063780 3300049823 Bacteria 3762
117 Ga0501044_0075235 3300049823 Bacteria 3428
118 Ga0501044_0532217 3300049823 Bacteria 1074
119 nmdc:mga03n38_12147_c1 3300050490 Bacteria 3232
120 nmdc:mga07m45_31854_c2 3300050496 Bacteria 2204
121 Ga0495601_0001362 3300053077 Bacteria 13442
122 Ga0495612_0000303 3300053078 Bacteria 19966
123 Ga0495612_0018958 3300053078 Bacteria 2754
124 Ga0500646_0000429 3300053090 Bacteria 12506
125 Ga0500568_0015633 3300053139 Bacteria 3394
126 2954381786 2954380949 Bacteria 10050426
127 2585303005 2582581313 Bacteria 10042643
128 2671834276 2671180195 Bacteria 9757215
129 2689995794 2687453743 Bacteria 8361025
130 2739606805 2739367654 Bacteria 6049412
131 2760624221 2758568621 Bacteria 5967089
132 2774852432 2773857922 Bacteria 9757215
133 2786674158 2786546132 Bacteria 10419719
134 2793977347 2791355406 Bacteria 11364898
135 2795795100 2795385472 Bacteria 6627535
136 2809025670 2808606394 Bacteria 6248540
137 2862284548 2862281513 Bacteria 9621493
138 2877684784 2877676314 Bacteria 9512378
139 2891396225 2891395885 Bacteria 9251614
140 2891567867 2891562705 Bacteria 8039471
141 2895437590 2895427314 Bacteria 13147766
142 2912727590 2912723979 Bacteria 8557534
143 2919055856 2919055335 Bacteria 3875751
144 2928153978 2928153084 Bacteria 4020257
145 2954681253 2954673503 Bacteria 9685905
146 2954682905 2954682443 Bacteria 9862841
147 2954712197 2954711539 Bacteria 10867210
148 2954722142 2954721474 Bacteria 10456478
149 2954739709 2954731030 Bacteria 10243860
150 2954741033 2954740390 Bacteria 10229294
151 2954758533 2954749733 Bacteria 10366972
152 2954760042 2954759201 Bacteria 9358192
153 8003314695 8003314358 Bacteria 10575343
154 8047903514 8047893842 Bacteria 11723082
155 8048356773 8048356638 Bacteria 11044339
156 8048379048 8048369669 Bacteria 11666822
157 8048388153 8048379754 Bacteria 11877923
158 rootH2_10177728
159 rootL2_10061073
160 rootL2_10160070
161 rootH1_10183008
162 Ga0006562J51391_1121065
163 Ga0006562J51391_1121066
164 Ga0068868_100367197
165 Ga0070709_10052589
166 Ga0070714_100046819
167 Ga0070713_100050710
168 Ga0070713_100099583
169 Ga0070663_100007413
170 Ga0070717_10422099
171 Ga0075363_100176376
172 Ga0075370_10060663
173 Ga0157372_10085868
174 Ga0182007_10005523
175 Ga0207700_10032347
176 Ga0207700_10129277
177 Ga0207664_10145115
178 Ga0207678_10000540
179 Ga0307515_10050686
180 Ga0307511_10105473
181 Ga0307513_10010349
182 Ga0307513_10018057
183 Ga0307513_10022767
184 Ga0307509_10024366
185 Ga0307514_10020142
186 Ga0307516_10024242
187 Ga0372808_007939
188 Ga0373925_0000053
189 Ga0395898_0001558
190 Ga0439448_0021985
191 Ga0450903_002650
192 Ga0466969_0041700
193 Ga0466972_0007630
194 Ga0466972_0009109
195 Ga0466972_0011902
196 Ga0466965_0049414
197 Ga0466966_0009155
198 Ga0466966_0043397
199 Ga0466961_0015879
200 Ga0466961_0076636
201 Ga0466961_0087921
202 Ga0466968_0043239
203 Ga0466960_0041090
204 Ga0466960_0060222
205 Ga0466959_0066762
206 Ga0466967_0081356
207 Ga0495627_003252
208 Ga0495592_0006975
209 Ga0495592_0015372
210 Ga0495592_0139775
211 Ga0495603_0050248
212 Ga0495603_0051095
213 Ga0495603_0260464
214 Ga0495603_0266751
215 Ga0495629_0005116
216 Ga0495629_0032237
217 Ga0495651_0002236
218 Ga0495651_0063698
219 Ga0495664_0123139
220 Ga0495664_0271886
221 Ga0495585_0036799
222 Ga0495618_0046029
223 Ga0495628_0015202
224 Ga0495628_0030892
225 Ga0495628_0204849
226 Ga0495666_0171637
227 Ga0495652_0027101
228 Ga0495652_0078245
229 Ga0495652_0350796
230 Ga0495640_0000407
231 Ga0495640_0007668
232 Ga0495640_0167055
233 Ga0495645_0010511
234 Ga0495645_0019529
235 Ga0495634_0024080
236 Ga0495634_0062037
237 Ga0495657_0029779
238 Ga0495657_0035164
239 Ga0495657_0055179
240 Ga0495623_0026013
241 Ga0495646_0070959
242 Ga0495613_0000524
243 Ga0495613_0035942
244 Ga0495613_0093725
245 Ga0495600_0001337
246 Ga0495600_0068433
247 Ga0495581_0051692
248 Ga0495581_0087396
249 Ga0495604_0014304
250 Ga0495604_0082865
251 Ga0495674_0027687
252 Ga0495676_0002231
253 Ga0495687_019905
254 Ga0495675_0114620
255 Ga0495685_078011
256 Ga0496114_0566250
257 Ga0496117_0006287
258 Ga0496119_0142483
259 Ga0496126_0007305
260 Ga0501031_0013315
261 Ga0501033_0201975
262 Ga0501033_0308188
263 Ga0501034_0153066
264 Ga0501036_0368812
265 Ga0501037_0103097
266 Ga0501038_0001543
267 Ga0501039_0577336
268 Ga0501043_0217264
269 Ga0501047_0090557
270 Ga0501047_0122691
271 Ga0501069_0317693
272 Ga0501080_0170741
273 Ga0501044_0063780
274 Ga0501044_0075235
275 Ga0501044_0532217
276 nmdc:mga03n38_12147_c1
277 nmdc:mga07m45_31854_c2
278 Ga0495601_0001362
279 Ga0495612_0000303
280 Ga0495612_0018958
281 Ga0500646_0000429
282 Ga0500568_0015633
283 2954381786
284 2585303005
285 2671834276
286 2689995794
287 2739606805
288 2760624221
289 2774852432
290 2786674158
291 2793977347
292 2795795100
293 2809025670
294 2862284548
295 2877684784
296 2891396225
297 2891567867
298 2895437590
299 2912727590
300 2919055856
301 2928153978
302 2954681253
303 2954682905
304 2954712197
305 2954722142
306 2954739709
307 2954741033
308 2954758533
309 2954760042
310 8003314695
311 8047903514
312 8048356773
313 8048379048
314 8048388153

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17765

MLTR_LBD

MmyB-like transcription regulator ligand binding domain

117

283

0.99

PF13560

HTH_31

Helix-turn-helix domain

18

97

0.96

PF01381

HTH_3

Helix-turn-helix

42

93

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yba-assembly1.cif.gz_A the structure of the c.kpn2i controller protein 0.9177 14 82
1utx-assembly1.cif.gz_B regulation of cytolysin expression by enterococcus faecalis: role of cylr2 0.9031 44 84
7t8i-assembly1.cif.gz_B crystal structure of the immr transcriptional regulator dna-binding domain of bacillus subtilis 0.8913 13 91
2gzu-assembly1.cif.gz_B high-resolution structure determination of the cylr2 homodimer using intermonomer distances from paramagnetic relaxation enhancement and nmr dipolar couplings 0.8882 43 84
6zvh-assembly1.cif.gz_i edf1-ribosome complex 0.8707 11 84
ID Description Score Start End Superfamily
4ybaA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9177 14 82 1.10.260.40
2gzuB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8882 43 84 1.10.260.40
2gzuA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8855 43 82 1.10.260.40
3pxpC01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8693 10 95 1.10.260.40
1y7yB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8646 8 88 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A2S8MG51-F1-model_v4 deleted 0.9679 133 285
AF-A0A1Q9SHU4-F1-model_v4 deleted 0.9662 111 280
AF-A0A7Y8P1Q2-F1-model_v4 deleted 0.9629 171 280
AF-A0A1C4Z2X4-F1-model_v4 MmyB-like transcription regulator ligand binding domain-containing protein 0.9576 121 236
AF-A0A1Q9SHU4-F1-model_v4 deleted 0.9552 111 280

Map