F228400

General Info

Members Datasets Scaffolds Average Seq Length
157 127 314 191

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_866_c1|nmdc:mga0n895_866_c1_5386_6012
Length 208
Sequence MGRDEAQGASNPEGCGTVRAMIAVIDNYDSFTWNLVQYLWELGAEVKVFRNDAISLAELKALAPSHVVISPGPCTPNEAGISLDTITGVSAPILGVCLGHQAIGQAFGGKVVRAGKVMHGKTSLIRHDEKGIFESLPNNFVATRYHSLVVQESSLPKDLQVTARAEDGEIMGLRHRLLPVEGVQFHPEALLTEHGHKMLQNFIKGSST

Samples

Sample ID Description Type Environment
1 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
79 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
80 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
81 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
82 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
83 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
84 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
85 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
86 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
87 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
88 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
89 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
90 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
93 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
97 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
98 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
99 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
100 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
101 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
102 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
103 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
104 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
105 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
106 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
107 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
108 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
109 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
110 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
114 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
115 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
116 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
117 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
118 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
119 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
120 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
121 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
122 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
123 2643221660 Methylibium sp. Root1272 Isolate Unclassified
124 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
125 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
126 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
127 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.82
Metatranscriptomes 0
Isolates 3.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.36
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0n895_866_c1 3300050512 Bacteria 21745
2 Ga0065707_10272576 3300005295 Bacteria 1062
3 Ga0070683_100087485 3300005329 Bacteria 2922
4 Ga0068869_100104020 3300005334 Bacteria 2152
5 Ga0070666_10015689 3300005335 Bacteria 4835
6 Ga0070671_100114497 3300005355 Bacteria 2267
7 Ga0070659_100030829 3300005366 Bacteria 4150
8 Ga0070667_100136409 3300005367 Bacteria 2145
9 Ga0070705_100042581 3300005440 Bacteria 2597
10 Ga0070705_100319630 3300005440 Bacteria 1120
11 Ga0070700_100351708 3300005441 Bacteria 1093
12 Ga0070700_100528477 3300005441 Bacteria 912
13 Ga0070694_100264567 3300005444 Bacteria 1305
14 Ga0070681_10121876 3300005458 Bacteria 2541
15 Ga0070706_100130593 3300005467 Bacteria 2344
16 Ga0070698_100058083 3300005471 Bacteria 3912
17 Ga0070679_100286865 3300005530 Bacteria 1598
18 Ga0070697_100003127 3300005536 Bacteria 12721
19 Ga0068853_100215804 3300005539 Bacteria 1750
20 Ga0070686_100071493 3300005544 Bacteria 2272
21 Ga0070686_100510169 3300005544 Bacteria 934
22 Ga0070695_100032973 3300005545 Bacteria 3239
23 Ga0070695_100254334 3300005545 Bacteria 1280
24 Ga0070696_100376333 3300005546 Bacteria 1106
25 Ga0070704_100007065 3300005549 Bacteria 6666
26 Ga0070704_100121348 3300005549 Bacteria 2008
27 Ga0070704_101058348 3300005549 Bacteria 736
28 Ga0068857_100020673 3300005577 Bacteria 5793
29 Ga0068854_100185139 3300005578 Bacteria 1628
30 Ga0068852_100108287 3300005616 Bacteria 2522
31 Ga0068852_101000901 3300005616 Bacteria 854
32 Ga0068860_100013984 3300005843 Bacteria 7871
33 Ga0081539_10000365 3300005985 Bacteria 99063
34 Ga0070716_100287331 3300006173 Bacteria 1138
35 Ga0068871_100491545 3300006358 Bacteria 1105
36 Ga0075430_100008118 3300006846 Bacteria 8872
37 Ga0075430_100011586 3300006846 Bacteria 7498
38 Ga0075431_100282085 3300006847 Bacteria 1682
39 Ga0075431_100686006 3300006847 Bacteria 1003
40 Ga0075433_10175727 3300006852 Bacteria 1906
41 Ga0075433_10303910 3300006852 Bacteria 1413
42 Ga0075434_100191518 3300006871 Bacteria 2066
43 Ga0075429_100000015 3300006880 Bacteria 78823
44 Ga0075436_100000087 3300006914 Bacteria 53435
45 Ga0075435_100043756 3300007076 Bacteria 3586
46 Ga0075435_100078849 3300007076 Bacteria 2702
47 Ga0099794_10016101 3300007265 Bacteria 3310
48 Ga0111539_10182021 3300009094 Bacteria 2454
49 Ga0111539_10322312 3300009094 Bacteria 1798
50 Ga0114129_10034102 3300009147 Bacteria 7189
51 Ga0114129_10250036 3300009147 Bacteria 2380
52 Ga0105239_10818294 3300010375 Bacteria 1067
53 Ga0105246_10082461 3300011119 Bacteria 2295
54 Ga0157373_10059076 3300013100 Bacteria 2717
55 Ga0157370_10528747 3300013104 Bacteria 1082
56 Ga0157374_10256390 3300013296 Bacteria 1722
57 Ga0157378_10021377 3300013297 Bacteria 5690
58 Ga0157372_10000293 3300013307 Bacteria 55642
59 Ga0157377_10318555 3300014745 Bacteria 1032
60 Ga0157379_10422877 3300014968 Bacteria 1227
61 Ga0157376_10577836 3300014969 Bacteria 1116
62 Ga0207680_10031677 3300025903 Bacteria 2997
63 Ga0207647_10029857 3300025904 Bacteria 3522
64 Ga0207684_10283835 3300025910 Bacteria 1427
65 Ga0207707_10089024 3300025912 Bacteria 2697
66 Ga0207695_10000664 3300025913 Bacteria 67787
67 Ga0207662_10063212 3300025918 Bacteria 2226
68 Ga0207657_10002088 3300025919 Bacteria 21607
69 Ga0207649_10012187 3300025920 Bacteria 4762
70 Ga0207694_10019872 3300025924 Bacteria 5082
71 Ga0207687_10089339 3300025927 Bacteria 2243
72 Ga0207644_10082425 3300025931 Bacteria 2380
73 Ga0207690_10608786 3300025932 Bacteria 892
74 Ga0207706_10030009 3300025933 Bacteria 4853
75 Ga0207689_10053492 3300025942 Bacteria 3326
76 Ga0207658_10055115 3300025986 Bacteria 2944
77 Ga0207703_10106532 3300026035 Bacteria 2385
78 Ga0207639_10000211 3300026041 Bacteria 43596
79 Ga0207708_10246484 3300026075 Bacteria 1438
80 Ga0207702_10270978 3300026078 Bacteria 1601
81 Ga0207648_10867588 3300026089 Bacteria 842
82 Ga0207674_10006333 3300026116 Bacteria 13933
83 Ga0207698_10003160 3300026142 Bacteria 9876
84 Ga0210000_1001283 3300027462 Bacteria 3536
85 Ga0209995_1031573 3300027471 Bacteria 888
86 Ga0209999_1001432 3300027543 Bacteria 4093
87 Ga0209971_1099839 3300027682 Bacteria 710
88 Ga0209998_10003269 3300027717 Bacteria 3569
89 Ga0207428_10179111 3300027907 Bacteria 1602
90 Ga0268264_10025663 3300028381 Bacteria 4813
91 Ga0265320_10130423 3300031240 Bacteria 1142
92 Ga0316575_10013846 3300031665 Bacteria 3018
93 Ga0316579_10014200 3300031691 Bacteria 3437
94 Ga0316578_10149452 3300031728 Bacteria 1407
95 Ga0307410_11015780 3300031852 Bacteria 716
96 Ga0316583_10027790 3300032133 Bacteria 2019
97 Ga0373934_0007704 3300035086 Bacteria 4003
98 Ga0373954_0005939 3300035118 Bacteria 5308
99 Ga0373946_0016578 3300035171 Bacteria 2808
100 Ga0373924_0037200 3300035410 Bacteria 1981
101 Ga0373935_0002303 3300035692 Bacteria 10889
102 Ga0373935_0475740 3300035692 Bacteria 905
103 Ga0373927_0326926 3300035695 Bacteria 1010
104 Ga0373933_0039388 3300035724 Bacteria 2780
105 Ga0373933_0732002 3300035724 Bacteria 651
106 Ga0373937_0001073 3300036401 Bacteria 23083
107 Ga0373937_0151524 3300036401 Bacteria 2172
108 Ga0316582_0020407 3300036647 Bacteria 3896
109 Ga0316584_0121017 3300036712 Bacteria 1956
110 Ga0373925_0220516 3300037068 Bacteria 1513
111 Ga0373925_0629340 3300037068 Bacteria 884
112 Ga0395905_0004542 3300037471 Bacteria 14375
113 Ga0316581_0005600 3300037588 Bacteria 3287
114 Ga0439446_0016659 3300042156 Bacteria 2048
115 Ga0451577_0286863 3300042876 Bacteria 1492
116 Ga0466966_0158455 3300044684 Bacteria 1379
117 Ga0453684_0127198 3300044712 Bacteria 3064
118 Ga0451576_0000261 3300045051 Bacteria 128730
119 Ga0451576_0023354 3300045051 Bacteria 6696
120 Ga0451576_0785821 3300045051 Bacteria 1000
121 Ga0451576_0819325 3300045051 Bacteria 977
122 Ga0495628_0429731 3300046516 Bacteria 961
123 Ga0495640_0316383 3300046533 Bacteria 967
124 Ga0495640_0334820 3300046533 Bacteria 936
125 Ga0495598_0033538 3300046537 Bacteria 1458
126 Ga0495598_0112084 3300046537 Bacteria 916
127 Ga0495621_0224030 3300046539 Bacteria 762
128 Ga0495634_0235727 3300046642 Bacteria 1124
129 Ga0495600_0505817 3300046809 Bacteria 742
130 Ga0495660_0211727 3300046810 Bacteria 919
131 Ga0495680_0056186 3300047322 Bacteria 3048
132 Ga0501040_0352642 3300049576 Bacteria 1054
133 Ga0501042_0239274 3300049578 Bacteria 1310
134 Ga0501048_0307219 3300049582 Bacteria 1129
135 Ga0501073_0039558 3300049589 Bacteria 3340
136 Ga0501074_0653144 3300049590 Bacteria 743
137 Ga0501080_0097502 3300049742 Bacteria 2730
138 nmdc:mga05p37_1196569_c1 3300050507 Bacteria 785
139 nmdc:mga05p37_133_c1 3300050507 Bacteria 68369
140 nmdc:mga09592_26_c1 3300050508 Bacteria 84260
141 nmdc:mga09592_7580_c1 3300050508 Bacteria 8827
142 nmdc:mga0qj67_10786_c1 3300050509 Bacteria 6834
143 nmdc:mga0qj67_314549_c1 3300050509 Bacteria 1268
144 nmdc:mga06r32_369305_c1 3300050510 Bacteria 1418
145 nmdc:mga06r32_69353_c1 3300050510 Bacteria 3407
146 nmdc:mga06r32_891838_c1 3300050510 Bacteria 846
147 nmdc:mga0n895_240928_c1 3300050512 Bacteria 1835
148 nmdc:mga0rr50_3308_c1 3300050513 Bacteria 9254
149 nmdc:mga0rr50_531178_c1 3300050513 Bacteria 1001
150 nmdc:mga0rr50_59832_c1 3300050513 Bacteria 2862
151 nmdc:mga08x19_1067_c1 3300050514 Bacteria 17100
152 nmdc:mga0a205_395130_c1 3300050515 Bacteria 1247
153 2644339147 2643221660 Bacteria 4208257
154 2938653492 2938649242 Bacteria 7118381
155 2968562260 2968558590 Bacteria 6956864
156 2988230104 2988225383 Bacteria 7221625
157 2996637431 2996632988 Bacteria 6921523
158 nmdc:mga0n895_866_c1
159 Ga0065707_10272576
160 Ga0070683_100087485
161 Ga0068869_100104020
162 Ga0070666_10015689
163 Ga0070671_100114497
164 Ga0070659_100030829
165 Ga0070667_100136409
166 Ga0070705_100042581
167 Ga0070705_100319630
168 Ga0070700_100351708
169 Ga0070700_100528477
170 Ga0070694_100264567
171 Ga0070681_10121876
172 Ga0070706_100130593
173 Ga0070698_100058083
174 Ga0070679_100286865
175 Ga0070697_100003127
176 Ga0068853_100215804
177 Ga0070686_100071493
178 Ga0070686_100510169
179 Ga0070695_100032973
180 Ga0070695_100254334
181 Ga0070696_100376333
182 Ga0070704_100007065
183 Ga0070704_100121348
184 Ga0070704_101058348
185 Ga0068857_100020673
186 Ga0068854_100185139
187 Ga0068852_100108287
188 Ga0068852_101000901
189 Ga0068860_100013984
190 Ga0081539_10000365
191 Ga0070716_100287331
192 Ga0068871_100491545
193 Ga0075430_100008118
194 Ga0075430_100011586
195 Ga0075431_100282085
196 Ga0075431_100686006
197 Ga0075433_10175727
198 Ga0075433_10303910
199 Ga0075434_100191518
200 Ga0075429_100000015
201 Ga0075436_100000087
202 Ga0075435_100043756
203 Ga0075435_100078849
204 Ga0099794_10016101
205 Ga0111539_10182021
206 Ga0111539_10322312
207 Ga0114129_10034102
208 Ga0114129_10250036
209 Ga0105239_10818294
210 Ga0105246_10082461
211 Ga0157373_10059076
212 Ga0157370_10528747
213 Ga0157374_10256390
214 Ga0157378_10021377
215 Ga0157372_10000293
216 Ga0157377_10318555
217 Ga0157379_10422877
218 Ga0157376_10577836
219 Ga0207680_10031677
220 Ga0207647_10029857
221 Ga0207684_10283835
222 Ga0207707_10089024
223 Ga0207695_10000664
224 Ga0207662_10063212
225 Ga0207657_10002088
226 Ga0207649_10012187
227 Ga0207694_10019872
228 Ga0207687_10089339
229 Ga0207644_10082425
230 Ga0207690_10608786
231 Ga0207706_10030009
232 Ga0207689_10053492
233 Ga0207658_10055115
234 Ga0207703_10106532
235 Ga0207639_10000211
236 Ga0207708_10246484
237 Ga0207702_10270978
238 Ga0207648_10867588
239 Ga0207674_10006333
240 Ga0207698_10003160
241 Ga0210000_1001283
242 Ga0209995_1031573
243 Ga0209999_1001432
244 Ga0209971_1099839
245 Ga0209998_10003269
246 Ga0207428_10179111
247 Ga0268264_10025663
248 Ga0265320_10130423
249 Ga0316575_10013846
250 Ga0316579_10014200
251 Ga0316578_10149452
252 Ga0307410_11015780
253 Ga0316583_10027790
254 Ga0373934_0007704
255 Ga0373954_0005939
256 Ga0373946_0016578
257 Ga0373924_0037200
258 Ga0373935_0002303
259 Ga0373935_0475740
260 Ga0373927_0326926
261 Ga0373933_0039388
262 Ga0373933_0732002
263 Ga0373937_0001073
264 Ga0373937_0151524
265 Ga0316582_0020407
266 Ga0316584_0121017
267 Ga0373925_0220516
268 Ga0373925_0629340
269 Ga0395905_0004542
270 Ga0316581_0005600
271 Ga0439446_0016659
272 Ga0451577_0286863
273 Ga0466966_0158455
274 Ga0453684_0127198
275 Ga0451576_0000261
276 Ga0451576_0023354
277 Ga0451576_0785821
278 Ga0451576_0819325
279 Ga0495628_0429731
280 Ga0495640_0316383
281 Ga0495640_0334820
282 Ga0495598_0033538
283 Ga0495598_0112084
284 Ga0495621_0224030
285 Ga0495634_0235727
286 Ga0495600_0505817
287 Ga0495660_0211727
288 Ga0495680_0056186
289 Ga0501040_0352642
290 Ga0501042_0239274
291 Ga0501048_0307219
292 Ga0501073_0039558
293 Ga0501074_0653144
294 Ga0501080_0097502
295 nmdc:mga05p37_1196569_c1
296 nmdc:mga05p37_133_c1
297 nmdc:mga09592_26_c1
298 nmdc:mga09592_7580_c1
299 nmdc:mga0qj67_10786_c1
300 nmdc:mga0qj67_314549_c1
301 nmdc:mga06r32_369305_c1
302 nmdc:mga06r32_69353_c1
303 nmdc:mga06r32_891838_c1
304 nmdc:mga0n895_240928_c1
305 nmdc:mga0rr50_3308_c1
306 nmdc:mga0rr50_531178_c1
307 nmdc:mga0rr50_59832_c1
308 nmdc:mga08x19_1067_c1
309 nmdc:mga0a205_395130_c1
310 2644339147
311 2938653492
312 2968562260
313 2988230104
314 2996637431

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00117

GATase

Glutamine amidotransferase class-I

23

205

0.96

PF07722

Peptidase_C26

Peptidase C26

82

188

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qur-assembly1.cif.gz_A mapping the allosteric communication network of aminodeoxychorismate synthase 0.9382 1 190
1qdl-assembly1.cif.gz_B-2 the crystal structure of anthranilate synthase from sulfolobus solfataricus 0.9349 2 188
6qur-assembly1.cif.gz_A mapping the allosteric communication network of aminodeoxychorismate synthase 0.9335 1 190
8hx6-assembly1.cif.gz_A crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae 0.9275 2 184
8hx6-assembly1.cif.gz_B crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae 0.9253 2 184
ID Description Score Start End Superfamily
af_P00903_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.968 1 185 3.40.50.880
af_K7L2D7_74_267_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9571 2 186 3.40.50.880
af_Q2G099_1_189_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9549 1 188 3.40.50.880
af_P00903_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9528 1 185 3.40.50.880
af_P9WN35_1_200_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9471 2 185 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A7M3PQ74-F1-model_v4 Athranilate synthase or para-amino-benzoate 0.9937 32 164 GO:0000162
GO:0004049
GO:0005829
AF-A0A0C3RJA9-F1-model_v4 Anthranilate synthase component II (EC 4.1.3.27) 0.9937 44 162 GO:0000162
GO:0004049
GO:0005829
GO:0046654
GO:0046820
AF-A0A2V8R0S8-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.9884 23 153 GO:0000162
GO:0004049
GO:0005829
AF-A0A7M3PQ74-F1-model_v4 Athranilate synthase or para-amino-benzoate 0.9863 32 164 GO:0000162
GO:0004049
GO:0005829
AF-A0A381QXX5-F1-model_v4 Glutamine amidotransferase domain-containing protein 0.9852 1 167 GO:0000162
GO:0004049
GO:0005829

Map