F228192

General Info

Members Datasets Scaffolds Average Seq Length
157 120 149 125

Family's Representative Sequence

Representative Sequence 3300048917|Ga0496114_0612848|Ga0496114_0612848_417_845
Length 142
Sequence MVGVIGRRHHIVIDCPDPGALAWFYSELLGLPITYRSEDWVVVSDDDTTSGFAFQLAPGHIPPRWPDPAWPQQFHLDVMVDDLDVAEPLVLGLGARRLDDGDHVYADPAGHPFCLIKRPPWADPISPALEGRAPTAGEASSG

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
3 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
4 2858868258 Micromonospora sp. MH33 Isolate Unclassified
5 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
6 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
7 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
73 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
74 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
75 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
76 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
77 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
78 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
79 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
82 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
83 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
84 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
87 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
88 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
89 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
90 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
91 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
92 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
93 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
94 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
95 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
96 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
97 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
98 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
99 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
100 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
101 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
102 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
103 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
104 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
105 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
106 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
107 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
108 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
109 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
110 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
111 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
112 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
114 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
115 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
116 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
117 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
118 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
119 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
120 649633069 Micromonospora sp. L5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.99
Metatranscriptomes 1.91
Isolates 5.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.64
Nodule 0
Rhizoplane 8.28
Rhizosphere 83.44
Stem 0
Stem Tuber 0
Unclassified 7.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10086022 3300005327 Bacteria 2586
2 Ga0070683_100021326 3300005329 Bacteria 5781
3 Ga0070683_100352051 3300005329 Bacteria 1402
4 Ga0070683_100916729 3300005329 Bacteria 841
5 Ga0070680_100133033 3300005336 Bacteria 2082
6 Ga0070680_100258562 3300005336 Bacteria 1472
7 Ga0070680_100283395 3300005336 Bacteria 1404
8 Ga0070680_100912530 3300005336 Bacteria 758
9 Ga0070682_101344350 3300005337 Bacteria 609
10 Ga0070682_101613550 3300005337 Bacteria 561
11 Ga0070660_100413088 3300005339 Bacteria 1117
12 Ga0070661_100217866 3300005344 Bacteria 1463
13 Ga0070692_10463943 3300005345 Bacteria 813
14 Ga0070667_100023489 3300005367 Bacteria 5116
15 Ga0070709_10166007 3300005434 Bacteria 1539
16 Ga0070713_100100424 3300005436 Bacteria 2505
17 Ga0070713_100415247 3300005436 Bacteria 1259
18 Ga0070708_100325467 3300005445 Bacteria 1448
19 Ga0070663_100111003 3300005455 Bacteria 2060
20 Ga0070663_100859713 3300005455 Bacteria 781
21 Ga0070662_100032611 3300005457 Bacteria 3661
22 Ga0070681_10013238 3300005458 Bacteria 8196
23 Ga0070681_12020852 3300005458 Bacteria 504
24 Ga0070685_10099132 3300005466 Bacteria 1777
25 Ga0070706_100017135 3300005467 Bacteria 6695
26 Ga0070707_100005949 3300005468 Bacteria 11382
27 Ga0070698_100068738 3300005471 Bacteria 3559
28 Ga0070679_100397677 3300005530 Bacteria 1324
29 Ga0070679_100903805 3300005530 Bacteria 826
30 Ga0070679_101727745 3300005530 Bacteria 574
31 Ga0070684_100929959 3300005535 Bacteria 815
32 Ga0070684_100933415 3300005535 Bacteria 813
33 Ga0070665_100118619 3300005548 Bacteria 2648
34 Ga0070665_101827338 3300005548 Bacteria 614
35 Ga0070664_100132518 3300005564 Bacteria 2190
36 Ga0070664_100411835 3300005564 Bacteria 1237
37 Ga0068857_101885146 3300005577 Bacteria 585
38 Ga0068856_101773298 3300005614 Bacteria 629
39 Ga0068858_100025275 3300005842 Bacteria 5527
40 Ga0068862_100156955 3300005844 Bacteria 2029
41 Ga0081455_10029346 3300005937 Bacteria 5015
42 Ga0081540_1029731 3300005983 Bacteria 3038
43 Ga0068871_101963810 3300006358 Bacteria 557
44 Ga0075430_100006720 3300006846 Bacteria 9703
45 Ga0075429_100010542 3300006880 Bacteria 7992
46 Ga0114129_10017673 3300009147 Bacteria 10153
47 Ga0157371_10994089 3300013102 Bacteria 640
48 Ga0157370_10512133 3300013104 Bacteria 1102
49 Ga0157369_10032295 3300013105 Bacteria 5759
50 Ga0157369_12637314 3300013105 Unclassified 507
51 Ga0157374_10918202 3300013296 Bacteria 893
52 Ga0157378_10221484 3300013297 Bacteria 1799
53 Ga0157372_10078092 3300013307 Bacteria 3740
54 Ga0157372_10255806 3300013307 Bacteria 2033
55 Ga0157375_12705003 3300013308 Bacteria 593
56 Ga0163163_10173602 3300014325 Bacteria 2202
57 Ga0163163_10884840 3300014325 Bacteria 956
58 Ga0157379_10843225 3300014968 Bacteria 867
59 Ga0206356_11711376 3300020070 Bacteria 1541
60 Ga0206353_10563767 3300020082 Bacteria 986
61 Ga0224712_10170851 3300022467 Bacteria 975
62 Ga0207705_10047501 3300025909 Bacteria 3087
63 Ga0207705_10277032 3300025909 Bacteria 1283
64 Ga0207684_10190824 3300025910 Bacteria 1767
65 Ga0207707_10036650 3300025912 Bacteria 4287
66 Ga0207660_10120876 3300025917 Bacteria 1983
67 Ga0207660_10198634 3300025917 Bacteria 1565
68 Ga0207660_10862597 3300025917 Bacteria 739
69 Ga0207657_10115592 3300025919 Bacteria 2211
70 Ga0207657_10340997 3300025919 Bacteria 1183
71 Ga0207649_10122726 3300025920 Bacteria 1754
72 Ga0207649_10552258 3300025920 Bacteria 881
73 Ga0207649_11208708 3300025920 Bacteria 597
74 Ga0207652_11249662 3300025921 Bacteria 645
75 Ga0207646_10004970 3300025922 Bacteria 14204
76 Ga0207706_10033770 3300025933 Bacteria 4553
77 Ga0207665_10237780 3300025939 Bacteria 1341
78 Ga0207661_10158338 3300025944 Bacteria 1963
79 Ga0207679_10026819 3300025945 Bacteria 3977
80 Ga0207668_10037948 3300025972 Bacteria 3229
81 Ga0207658_10402745 3300025986 Bacteria 1203
82 Ga0207703_10056118 3300026035 Bacteria 3207
83 Ga0207678_10347232 3300026067 Bacteria 1279
84 Ga0207675_100215134 3300026118 Bacteria 1850
85 Ga0207683_10762930 3300026121 Bacteria 897
86 Ga0268266_11438094 3300028379 Bacteria 665
87 Ga0268265_10610973 3300028380 Bacteria 1043
88 Ga0307509_10014380 3300031507 Bacteria 9306
89 Ga0307408_102229959 3300031548 Bacteria 530
90 Ga0307516_10452061 3300031730 Bacteria 941
91 Ga0307405_10084545 3300031731 Bacteria 2083
92 Ga0307413_10316678 3300031824 Bacteria 1190
93 Ga0307410_11380415 3300031852 Bacteria 618
94 Ga0307407_10533308 3300031903 Bacteria 865
95 Ga0307407_11402539 3300031903 Bacteria 550
96 Ga0307409_100140407 3300031995 Bacteria 2081
97 Ga0307409_100638721 3300031995 Bacteria 1057
98 Ga0307416_100610122 3300032002 Bacteria 1172
99 Ga0307416_102426668 3300032002 Bacteria 624
100 Ga0307416_103051527 3300032002 Bacteria 560
101 Ga0307415_100035791 3300032126 Bacteria 3246
102 Ga0307507_10210924 3300033179 Bacteria 1324
103 Ga0373947_0909370 3300035725 Bacteria 601
104 Ga0373925_0950566 3300037068 Bacteria 708
105 Ga0395900_0941121 3300037418 Bacteria 786
106 Ga0451835_0834133 3300041492 Bacteria 559
107 Ga0451853_3097644 3300041512 Bacteria 770
108 Ga0450912_021579 3300042116 Bacteria 626
109 Ga0466972_0615831 3300044658 Bacteria 514
110 Ga0466966_0081136 3300044684 Bacteria 2020
111 Ga0466961_0262839 3300044693 Bacteria 1058
112 Ga0466961_0513968 3300044693 Bacteria 723
113 Ga0466963_0001664 3300044694 Bacteria 12111
114 Ga0466963_0064955 3300044694 Bacteria 2446
115 Ga0466971_0025342 3300044719 Bacteria 2648
116 Ga0466970_0111226 3300044765 Bacteria 1496
117 Ga0466957_0026329 3300044842 Bacteria 3450
118 Ga0466957_0090490 3300044842 Bacteria 1916
119 Ga0466960_0018079 3300044901 Bacteria 3084
120 Ga0466958_0017810 3300045836 Bacteria 4114
121 Ga0466967_0002683 3300045976 Bacteria 11236
122 Ga0466967_0877244 3300045976 Bacteria 892
123 Ga0466967_1406775 3300045976 Bacteria 695
124 Ga0495629_0861351 3300046459 Bacteria 595
125 Ga0495580_0455171 3300046472 Unclassified 858
126 Ga0495622_0404226 3300046557 Bacteria 588
127 Ga0495672_0136093 3300047320 Bacteria 1288
128 Ga0496101_0343579 3300048904 Bacteria 1172
129 Ga0496102_0005077 3300048905 Bacteria 11147
130 Ga0496102_0029374 3300048905 Bacteria 4920
131 Ga0496103_0005184 3300048906 Bacteria 7840
132 Ga0496104_0201550 3300048907 Bacteria 1902
133 Ga0496108_0000145 3300048911 Bacteria 68378
134 Ga0496112_0978729 3300048915 Bacteria 766
135 Ga0496114_0035035 3300048917 Bacteria 4144
136 Ga0496114_0047124 3300048917 Bacteria 3584
137 Ga0496114_0120270 3300048917 Unclassified 2258
138 Ga0496114_0612848 3300048917 Bacteria 959
139 Ga0496115_0137751 3300048918 Unclassified 2013
140 Ga0496115_0246470 3300048918 Bacteria 1472
141 Ga0496119_0343193 3300048922 Bacteria 725
142 Ga0501047_0277050 3300049581 Bacteria 1523
143 Ga0501070_0833740 3300049586 Bacteria 722
144 nmdc:mga05p37_501657_c1 3300050507 Bacteria 1393
145 nmdc:mga09592_34201_c1 3300050508 Bacteria 4249
146 nmdc:mga0qj67_162510_c1 3300050509 Bacteria 1813
147 Ga0500579_248489 3300053143 Bacteria 580
148 Ga0466962_0083448 3300061719 Bacteria 1529
149 Ga0530510_0898781 3300061734 Bacteria 677

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005329 Ga0070683_100916729 Ga0070683_1009167292 105
2 3300005329 Ga0070683_100021326 Ga0070683_1000213261 110
3 3300005336 Ga0070680_100133033 Ga0070680_1001330333 110
4 3300005336 Ga0070680_100283395 Ga0070680_1002833952 110
5 3300005339 Ga0070660_100413088 Ga0070660_1004130881 110
6 3300005344 Ga0070661_100217866 Ga0070661_1002178662 110
7 3300005345 Ga0070692_10463943 Ga0070692_104639432 110
8 3300005434 Ga0070709_10166007 Ga0070709_101660072 110
9 3300005436 Ga0070713_100100424 Ga0070713_1001004242 110
10 3300005458 Ga0070681_12020852 Ga0070681_120208521 110
11 3300005530 Ga0070679_100397677 Ga0070679_1003976772 110
12 3300005530 Ga0070679_100903805 Ga0070679_1009038051 110
13 3300005530 Ga0070679_101727745 Ga0070679_1017277451 110
14 3300005535 Ga0070684_100933415 Ga0070684_1009334151 110
15 3300005564 Ga0070664_100132518 Ga0070664_1001325182 110
16 3300005577 Ga0068857_101885146 Ga0068857_1018851462 110
17 3300013105 Ga0157369_12637314 Ga0157369_126373141 110
18 3300013307 Ga0157372_10255806 Ga0157372_102558062 110
19 3300014325 Ga0163163_10173602 Ga0163163_101736023 110
20 3300020070 Ga0206356_11711376 Ga0206356_117113763 110
21 3300025917 Ga0207660_10120876 Ga0207660_101208763 110
22 3300025919 Ga0207657_10115592 Ga0207657_101155921 110
23 3300025920 Ga0207649_10122726 Ga0207649_101227263 110
24 3300025920 Ga0207649_10552258 Ga0207649_105522582 110
25 3300025920 Ga0207649_11208708 Ga0207649_112087081 110
26 3300025921 Ga0207652_11249662 Ga0207652_112496622 110
27 3300025939 Ga0207665_10237780 Ga0207665_102377803 110
28 3300025945 Ga0207679_10026819 Ga0207679_100268193 110
29 3300031903 Ga0307407_11402539 Ga0307407_114025391 110
30 3300031995 Ga0307409_100638721 Ga0307409_1006387211 110
31 3300032126 Ga0307415_100035791 Ga0307415_1000357913 110
32 3300037068 Ga0373925_0950566 Ga0373925_0950566_343_690 114
33 3300048922 Ga0496119_0343193 Ga0496119_0343193_360_710 115
34 3300005336 Ga0070680_100912530 Ga0070680_1009125301 117
35 3300005337 Ga0070682_101344350 Ga0070682_1013443501 117
36 3300005367 Ga0070667_100023489 Ga0070667_1000234894 117
37 3300005445 Ga0070708_100325467 Ga0070708_1003254672 117
38 3300005455 Ga0070663_100111003 Ga0070663_1001110032 117
39 3300005457 Ga0070662_100032611 Ga0070662_1000326112 117
40 3300005466 Ga0070685_10099132 Ga0070685_100991322 117
41 3300005467 Ga0070706_100017135 Ga0070706_1000171357 117
42 3300005468 Ga0070707_100005949 Ga0070707_1000059492 117
43 3300005471 Ga0070698_100068738 Ga0070698_1000687383 117
44 3300005535 Ga0070684_100929959 Ga0070684_1009299591 117
45 3300005564 Ga0070664_100411835 Ga0070664_1004118352 117
46 3300005614 Ga0068856_101773298 Ga0068856_1017732982 117
47 3300005842 Ga0068858_100025275 Ga0068858_1000252755 117
48 3300005844 Ga0068862_100156955 Ga0068862_1001569553 117
49 3300005983 Ga0081540_1029731 Ga0081540_10297312 117
50 3300006358 Ga0068871_101963810 Ga0068871_1019638102 117
51 3300013297 Ga0157378_10221484 Ga0157378_102214842 117
52 3300013308 Ga0157375_12705003 Ga0157375_127050031 117
53 3300014325 Ga0163163_10884840 Ga0163163_108848401 117
54 3300014968 Ga0157379_10843225 Ga0157379_108432252 117
55 3300025910 Ga0207684_10190824 Ga0207684_101908242 117
56 3300025917 Ga0207660_10862597 Ga0207660_108625972 117
57 3300025922 Ga0207646_10004970 Ga0207646_1000497018 117
58 3300025933 Ga0207706_10033770 Ga0207706_100337703 117
59 3300025972 Ga0207668_10037948 Ga0207668_100379481 117
60 3300025986 Ga0207658_10402745 Ga0207658_104027452 117
61 3300026035 Ga0207703_10056118 Ga0207703_100561184 117
62 3300026067 Ga0207678_10347232 Ga0207678_103472322 117
63 3300026118 Ga0207675_100215134 Ga0207675_1002151343 117
64 3300028380 Ga0268265_10610973 Ga0268265_106109732 117
65 3300031730 Ga0307516_10452061 Ga0307516_104520611 117
66 3300031995 Ga0307409_100140407 Ga0307409_1001404072 117
67 3300032002 Ga0307416_100610122 Ga0307416_1006101223 117
68 3300032002 Ga0307416_103051527 Ga0307416_1030515271 117
69 3300033179 Ga0307507_10210924 Ga0307507_102109242 117
70 3300035725 Ga0373947_0909370 Ga0373947_0909370_38_418 117
71 3300045976 Ga0466967_0877244 Ga0466967_0877244_244_612 117
72 3300048911 Ga0496108_0000145 Ga0496108_0000145_48160_48540 117
73 iso_pu_bacteria 2858868258 2858870484 117
74 iso_pu_bacteria 2867312974 2867314639 117
75 iso_pu_bacteria 2867319477 2867322347 117
76 iso_pu_bacteria 2919446982 2919448882 117
77 3300013296 Ga0157374_10918202 Ga0157374_109182021 118
78 3300031507 Ga0307509_10014380 Ga0307509_100143803 118
79 3300037418 Ga0395900_0941121 Ga0395900_0941121_169_540 118
80 3300041492 Ga0451835_0834133 Ga0451835_0834133_45_419 118
81 3300041512 Ga0451853_3097644 Ga0451853_3097644_90_464 118
82 3300044694 Ga0466963_0064955 Ga0466963_0064955_659_1030 118
83 3300044842 Ga0466957_0026329 Ga0466957_0026329_1487_1864 118
84 3300045976 Ga0466967_1406775 Ga0466967_1406775_45_416 118
85 3300046459 Ga0495629_0861351 Ga0495629_0861351_50_424 118
86 3300048904 Ga0496101_0343579 Ga0496101_0343579_356_739 118
87 3300048905 Ga0496102_0005077 Ga0496102_0005077_9081_9464 118
88 3300048905 Ga0496102_0029374 Ga0496102_0029374_2644_3018 118
89 3300048906 Ga0496103_0005184 Ga0496103_0005184_3148_3531 118
90 3300048917 Ga0496114_0035035 Ga0496114_0035035_626_1009 118
91 3300048917 Ga0496114_0047124 Ga0496114_0047124_917_1291 118
92 3300048918 Ga0496115_0246470 Ga0496115_0246470_807_1181 118
93 3300049581 Ga0501047_0277050 Ga0501047_0277050_286_663 118
94 3300053143 Ga0500579_248489 Ga0500579_248489_35_418 118
95 3300005436 Ga0070713_100415247 Ga0070713_1004152471 119
96 3300005548 Ga0070665_100118619 Ga0070665_1001186191 119
97 3300005548 Ga0070665_101827338 Ga0070665_1018273382 119
98 3300005937 Ga0081455_10029346 Ga0081455_100293467 119
99 3300013102 Ga0157371_10994089 Ga0157371_109940891 119
100 3300013307 Ga0157372_10078092 Ga0157372_100780923 119
101 3300028379 Ga0268266_11438094 Ga0268266_114380942 119
102 3300031548 Ga0307408_102229959 Ga0307408_1022299591 119
103 3300031852 Ga0307410_11380415 Ga0307410_113804151 119
104 3300032002 Ga0307416_102426668 Ga0307416_1024266682 119
105 3300042116 Ga0450912_021579 Ga0450912_021579_247_609 119
106 3300044684 Ga0466966_0081136 Ga0466966_0081136_1039_1455 119
107 3300044693 Ga0466961_0262839 Ga0466961_0262839_549_938 119
108 3300044693 Ga0466961_0513968 Ga0466961_0513968_181_597 119
109 3300044765 Ga0466970_0111226 Ga0466970_0111226_321_710 119
110 3300046472 Ga0495580_0455171 Ga0495580_0455171_157_531 119
111 3300046557 Ga0495622_0404226 Ga0495622_0404226_116_490 119
112 3300048907 Ga0496104_0201550 Ga0496104_0201550_1401_1784 119
113 3300048915 Ga0496112_0978729 Ga0496112_0978729_14_391 119
114 3300048917 Ga0496114_0120270 Ga0496114_0120270_395_778 119
115 3300048918 Ga0496115_0137751 Ga0496115_0137751_874_1257 119
116 3300049586 Ga0501070_0833740 Ga0501070_0833740_110_484 119
117 3300031731 Ga0307405_10084545 Ga0307405_100845452 120
118 3300031824 Ga0307413_10316678 Ga0307413_103166782 120
119 3300031903 Ga0307407_10533308 Ga0307407_105333081 120
120 iso_pu_bacteria 2501939600 2501944473 120
121 iso_pu_bacteria 2837268691 2837269447 120
122 iso_pu_bacteria 2856858025 2856862434 120
123 iso_pu_bacteria 649633069 649815779 120
124 3300005329 Ga0070683_100352051 Ga0070683_1003520513 121
125 3300005336 Ga0070680_100258562 Ga0070680_1002585622 121
126 3300005337 Ga0070682_101613550 Ga0070682_1016135501 121
127 3300005455 Ga0070663_100859713 Ga0070663_1008597131 121
128 3300005458 Ga0070681_10013238 Ga0070681_100132382 121
129 3300006846 Ga0075430_100006720 Ga0075430_1000067204 121
130 3300006880 Ga0075429_100010542 Ga0075429_1000105425 121
131 3300009147 Ga0114129_10017673 Ga0114129_100176735 121
132 3300013104 Ga0157370_10512133 Ga0157370_105121331 121
133 3300013105 Ga0157369_10032295 Ga0157369_100322951 121
134 3300020082 Ga0206353_10563767 Ga0206353_105637671 121
135 3300025909 Ga0207705_10277032 Ga0207705_102770322 121
136 3300025912 Ga0207707_10036650 Ga0207707_100366504 121
137 3300025917 Ga0207660_10198634 Ga0207660_101986342 121
138 3300025919 Ga0207657_10340997 Ga0207657_103409972 121
139 3300025944 Ga0207661_10158338 Ga0207661_101583381 121
140 3300026121 Ga0207683_10762930 Ga0207683_107629301 121
141 3300044658 Ga0466972_0615831 Ga0466972_0615831_70_450 121
142 3300044694 Ga0466963_0001664 Ga0466963_0001664_9768_10148 121
143 3300044719 Ga0466971_0025342 Ga0466971_0025342_2200_2580 121
144 3300044842 Ga0466957_0090490 Ga0466957_0090490_669_1049 121
145 3300044901 Ga0466960_0018079 Ga0466960_0018079_1303_1683 121
146 3300045836 Ga0466958_0017810 Ga0466958_0017810_450_830 121
147 3300045976 Ga0466967_0002683 Ga0466967_0002683_8618_8998 121
148 3300050507 nmdc:mga05p37_501657_c1 nmdc:mga05p37_501657_c1_814_1203 121
149 3300050508 nmdc:mga09592_34201_c1 nmdc:mga09592_34201_c1_919_1308 121
150 3300050509 nmdc:mga0qj67_162510_c1 nmdc:mga0qj67_162510_c1_829_1218 121
151 3300061719 Ga0466962_0083448 Ga0466962_0083448_246_626 121
152 3300047320 Ga0495672_0136093 Ga0495672_0136093_415_801 123
153 3300061734 Ga0530510_0898781 Ga0530510_0898781_129_539 124
154 3300005327 Ga0070658_10086022 Ga0070658_100860222 126
155 3300022467 Ga0224712_10170851 Ga0224712_101708512 126
156 3300025909 Ga0207705_10047501 Ga0207705_100475013 126
157 3300048917 Ga0496114_0612848 Ga0496114_0612848_417_845 126

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18029

Glyoxalase_6

Glyoxalase-like domain

10

116

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nb0-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution 0.752 1 111
4nb2-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure 0.749 1 113
4nb1-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.80 angstrom resolution with l-cysteine-cys9 disulfide 0.746 1 113
5f6q-assembly1.cif.gz_A crystal structure of metallothiol transferase from bacillus anthracis str. ames 0.7332 1 113
8dtd-assembly1.cif.gz_A crystal structure of fosb from bacillus cereus with zinc and phosphonoformate 0.7258 1 113
ID Description Score Start End Superfamily
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7614 67 109 3.30.720.110
3vcxB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.757 3 50 3.30.720.120
af_Q5VMX8_15_124_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7512 4 109 3.10.180.10
af_K7KBB9_206_354_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7483 3 49 3.10.180.10
af_O06633_2_115_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7399 2 110 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A286EQK8-F1-model_v4 Glyoxalase-like domain-containing protein 0.9777 1 116
AF-A0A1N7F8W9-F1-model_v4 Glyoxalase-like domain-containing protein 0.9698 1 118
AF-G8SBW9-F1-model_v4 Glyoxalase-like domain-containing protein 0.9694 4 118
AF-G8SBW9-F1-model_v4 Glyoxalase-like domain-containing protein 0.9613 4 118
AF-A0A6N7HLA5-F1-model_v4 Glyoxalase 0.9597 1 118

Feature Viewer

pLDDT pTM Quality
89.33 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map