F227817

General Info

Members Datasets Scaffolds Average Seq Length
157 125 314 186

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0892376|Ga0395905_0892376_101_757
Length 218
Sequence MMRQHLAALRAAVQDGLQGGSPIHDRRADRGDVGMEVVSLAIPDVKLVTPRRFADPRGFFAETFSRRRFAEAGLVADFMQDNQSLSRPRGTVRGLHFQRPPFAQAKLVRVLRGAIYDVAVDIRPGSPSYGRHVATEITAESGAMILVPEGFAHGFCTLQPDTEVFYKVNRDYAPQHEGGIQWNDPALGIAWPVAAADAVLSERDRTWPTLSAYAGSDA

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
29 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
40 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
41 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
42 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
64 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
65 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
66 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
67 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
68 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
69 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
70 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
71 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
72 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
73 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
74 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
75 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
76 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
77 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
78 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
79 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
80 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
81 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
82 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
83 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
84 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
86 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
87 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
88 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
89 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
90 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
91 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
92 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
93 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
94 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
95 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
96 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
102 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
103 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
104 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
105 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
106 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
107 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
108 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
109 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
110 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
111 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
112 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
113 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
114 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
115 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
116 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
117 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
118 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
119 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
120 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
121 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
122 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
123 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
124 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
125 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.64
Nodule 0
Rhizoplane 3.18
Rhizosphere 92.99
Stem 0
Stem Tuber 0
Unclassified 8.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0892376 3300037471 Bacteria 792
2 Ga0070690_100004341 3300005330 Bacteria 7861
3 Ga0070677_10037776 3300005333 Bacteria 1885
4 Ga0070682_100004098 3300005337 Bacteria 8090
5 Ga0070682_100109116 3300005337 Bacteria 1841
6 Ga0070682_100445449 3300005337 Bacteria 990
7 Ga0070682_101100537 3300005337 Archaea 665
8 Ga0070689_100001284 3300005340 Bacteria 15979
9 Ga0070669_100263723 3300005353 Bacteria 1375
10 Ga0070671_100280077 3300005355 Bacteria 1418
11 Ga0070688_100046161 3300005365 Bacteria 2696
12 Ga0070688_100064532 3300005365 Bacteria 2324
13 Ga0070659_100156509 3300005366 Bacteria 1861
14 Ga0070714_100351682 3300005435 Bacteria 1384
15 Ga0070708_100253456 3300005445 Bacteria 1653
16 Ga0070662_101067982 3300005457 Bacteria 692
17 Ga0070681_10040993 3300005458 Bacteria 4639
18 Ga0070681_10218560 3300005458 Bacteria 1821
19 Ga0068867_100425977 3300005459 Bacteria 1125
20 Ga0068867_100537366 3300005459 Bacteria 1010
21 Ga0070685_10023642 3300005466 Bacteria 3367
22 Ga0070685_10664395 3300005466 Unclassified 756
23 Ga0070698_100886434 3300005471 Bacteria 838
24 Ga0070697_100026054 3300005536 Bacteria 4666
25 Ga0070686_100023826 3300005544 Bacteria 3664
26 Ga0068855_100119506 3300005563 Bacteria 3017
27 Ga0068852_100231006 3300005616 Bacteria 1763
28 Ga0068864_100032663 3300005618 Bacteria 4423
29 Ga0068860_100036791 3300005843 Bacteria 4688
30 Ga0068862_100222561 3300005844 Bacteria 1709
31 Ga0097621_100353539 3300006237 Bacteria 1307
32 Ga0075430_100117007 3300006846 Bacteria 2221
33 Ga0075434_100009215 3300006871 Bacteria 9195
34 Ga0105240_10000581 3300009093 Bacteria 67884
35 Ga0105243_10066296 3300009148 Bacteria 2903
36 Ga0105242_10044894 3300009176 Bacteria 3579
37 Ga0105248_10060141 3300009177 Bacteria 4265
38 Ga0105248_11139838 3300009177 Bacteria 881
39 Ga0105249_11425238 3300009553 Bacteria 765
40 Ga0105246_10085825 3300011119 Unclassified 2255
41 Ga0157370_10441857 3300013104 Bacteria 1196
42 Ga0163162_10099227 3300013306 Bacteria 3003
43 Ga0157372_10087100 3300013307 Bacteria 3543
44 Ga0157372_10127500 3300013307 Bacteria 2926
45 Ga0157375_10508951 3300013308 Bacteria 1368
46 Ga0163163_10086383 3300014325 Bacteria 3146
47 Ga0157379_10174758 3300014968 Bacteria 1939
48 Ga0157379_10202986 3300014968 Bacteria 1793
49 Ga0157376_10165698 3300014969 Bacteria 2008
50 Ga0213872_10000954 3300021361 Bacteria 20225
51 Ga0213872_10004386 3300021361 Bacteria 7509
52 Ga0213872_10008894 3300021361 Bacteria 4835
53 Ga0213872_10080298 3300021361 Bacteria 1465
54 Ga0213872_10127140 3300021361 Bacteria 1124
55 Ga0213875_10000910 3300021388 Bacteria 21437
56 Ga0207697_10091962 3300025315 Unclassified 1286
57 Ga0207682_10130610 3300025893 Bacteria 1121
58 Ga0207684_10220901 3300025910 Bacteria 1635
59 Ga0207707_10080012 3300025912 Bacteria 2853
60 Ga0207695_10004246 3300025913 Bacteria 19682
61 Ga0207660_10238410 3300025917 Bacteria 1432
62 Ga0207646_10034103 3300025922 Bacteria 4600
63 Ga0207681_10251076 3300025923 Bacteria 1381
64 Ga0207664_10280922 3300025929 Bacteria 1461
65 Ga0207690_10092523 3300025932 Bacteria 2140
66 Ga0207709_10039680 3300025935 Bacteria 2814
67 Ga0207670_10005161 3300025936 Bacteria 7139
68 Ga0207670_10234901 3300025936 Bacteria 1410
69 Ga0207669_10132639 3300025937 Unclassified 1715
70 Ga0207711_10592224 3300025941 Unclassified 1034
71 Ga0207711_10682751 3300025941 Unclassified 958
72 Ga0207667_11121485 3300025949 Bacteria 769
73 Ga0207668_10331056 3300025972 Unclassified 1267
74 Ga0207677_11058293 3300026023 Unclassified 738
75 Ga0207703_10348431 3300026035 Bacteria 1363
76 Ga0207641_10064763 3300026088 Bacteria 3125
77 Ga0207648_10505967 3300026089 Bacteria 1106
78 Ga0207648_11294996 3300026089 Bacteria 685
79 Ga0207676_10013601 3300026095 Bacteria 5841
80 Ga0265326_10011680 3300028558 Bacteria 2586
81 Ga0265318_10049062 3300028577 Bacteria 1589
82 Ga0265338_10019227 3300028800 Bacteria 7266
83 Ga0265328_10000043 3300031239 Bacteria 89024
84 Ga0265340_10023363 3300031247 Bacteria 3153
85 Ga0265339_10237185 3300031249 Unclassified 887
86 Ga0265331_10002771 3300031250 Bacteria 11639
87 Ga0265327_10007722 3300031251 Bacteria 8227
88 Ga0265327_10028530 3300031251 Bacteria 3191
89 Ga0265327_10133098 3300031251 Bacteria 1168
90 Ga0265316_10102518 3300031344 Bacteria 2173
91 Ga0316575_10047202 3300031665 Bacteria 1712
92 Ga0316579_10202610 3300031691 Bacteria 960
93 Ga0265314_10284444 3300031711 Unclassified 934
94 Ga0316576_10017505 3300031727 Bacteria 4872
95 Ga0316576_10201921 3300031727 Bacteria 1497
96 Ga0307414_10346299 3300032004 Bacteria 1274
97 Ga0373954_0389307 3300035118 Bacteria 689
98 Ga0373955_0111520 3300035172 Bacteria 1582
99 Ga0373931_0040716 3300035691 Bacteria 2439
100 Ga0373933_0062717 3300035724 Bacteria 2246
101 Ga0373947_0245698 3300035725 Unclassified 1182
102 Ga0373937_0026024 3300036401 Bacteria 5286
103 Ga0373937_0052643 3300036401 Bacteria 3733
104 Ga0316582_0127943 3300036647 Bacteria 1704
105 Ga0373925_0863090 3300037068 Unclassified 746
106 Ga0436364_0449559 3300037853 Bacteria 73062
107 Ga0436364_0611833 3300037853 Bacteria 6623
108 Ga0436364_1335081 3300037853 Bacteria 821
109 Ga0436360_0140719 3300039438 Bacteria 1139
110 Ga0436360_1123045 3300039438 Bacteria 2392
111 Ga0436361_0151690 3300039447 Bacteria 6260
112 Ga0436361_0250339 3300039447 Bacteria 1667
113 Ga0436361_0292589 3300039447 Bacteria 3609
114 Ga0436361_0421456 3300039447 Bacteria 2910
115 Ga0436361_0444089 3300039447 Bacteria 1828
116 Ga0436361_0712546 3300039447 Bacteria 1425
117 Ga0436361_0742943 3300039447 Bacteria 946
118 Ga0436361_0977388 3300039447 Bacteria 2415
119 Ga0436363_1558956 3300039450 Bacteria 1364
120 Ga0436362_0110435 3300039453 Bacteria 4813
121 Ga0451791_1061556 3300041451 Bacteria 841
122 Ga0451807_1085638 3300041486 Bacteria 2071
123 Ga0439445_0079450 3300042004 Bacteria 915
124 Ga0466972_0000029 3300044658 Bacteria 165236
125 Ga0466965_0065435 3300044683 Bacteria 1822
126 Ga0466961_0186745 3300044693 Bacteria 1286
127 Ga0466971_0033445 3300044719 Bacteria 2304
128 Ga0466957_0004713 3300044842 Bacteria 7633
129 Ga0466959_0310591 3300045049 Bacteria 1079
130 Ga0466958_0000283 3300045836 Bacteria 19727
131 Ga0466967_0257495 3300045976 Bacteria 1669
132 Ga0495592_0023549 3300046454 Bacteria 4684
133 Ga0495629_0545154 3300046459 Unclassified 779
134 Ga0495639_0067434 3300046475 Bacteria 1648
135 Ga0495586_0160303 3300046535 Bacteria 1269
136 Ga0495667_0235314 3300046559 Bacteria 1167
137 Ga0495634_0089023 3300046642 Bacteria 2007
138 Ga0495657_0118241 3300046675 Bacteria 1672
139 Ga0495599_0054960 3300046678 Bacteria 2494
140 Ga0495680_0017310 3300047322 Bacteria 6158
141 Ga0496108_0619253 3300048911 Bacteria 942
142 Ga0496109_0037157 3300048912 Bacteria 4400
143 Ga0496110_0886088 3300048913 Bacteria 798
144 Ga0501067_0215625 3300049583 Bacteria 1069
145 Ga0501070_0107876 3300049586 Bacteria 2301
146 Ga0501080_0064651 3300049742 Bacteria 3403
147 Ga0501080_0570798 3300049742 Bacteria 1006
148 nmdc:mga0qj67_144565_c1 3300050509 Bacteria 1928
149 nmdc:mga0n895_28859_c1 3300050512 Bacteria 5283
150 nmdc:mga0rr50_532249_c1 3300050513 Bacteria 1000
151 Ga0495601_0123261 3300053077 Bacteria 1684
152 Ga0495619_0007198 3300053085 Bacteria 7048
153 Ga0500641_0002840 3300053096 Bacteria 6137
154 Ga0590071_060505 3300059421 Bacteria 925
155 Ga0590075_018048 3300059424 Bacteria 1743
156 Ga0501082_0047805 3300060353 Bacteria 3687
157 Ga0466962_0007675 3300061719 Bacteria 5169
158 Ga0395905_0892376
159 Ga0070690_100004341
160 Ga0070677_10037776
161 Ga0070682_100004098
162 Ga0070682_100109116
163 Ga0070682_100445449
164 Ga0070682_101100537
165 Ga0070689_100001284
166 Ga0070669_100263723
167 Ga0070671_100280077
168 Ga0070688_100046161
169 Ga0070688_100064532
170 Ga0070659_100156509
171 Ga0070714_100351682
172 Ga0070708_100253456
173 Ga0070662_101067982
174 Ga0070681_10040993
175 Ga0070681_10218560
176 Ga0068867_100425977
177 Ga0068867_100537366
178 Ga0070685_10023642
179 Ga0070685_10664395
180 Ga0070698_100886434
181 Ga0070697_100026054
182 Ga0070686_100023826
183 Ga0068855_100119506
184 Ga0068852_100231006
185 Ga0068864_100032663
186 Ga0068860_100036791
187 Ga0068862_100222561
188 Ga0097621_100353539
189 Ga0075430_100117007
190 Ga0075434_100009215
191 Ga0105240_10000581
192 Ga0105243_10066296
193 Ga0105242_10044894
194 Ga0105248_10060141
195 Ga0105248_11139838
196 Ga0105249_11425238
197 Ga0105246_10085825
198 Ga0157370_10441857
199 Ga0163162_10099227
200 Ga0157372_10087100
201 Ga0157372_10127500
202 Ga0157375_10508951
203 Ga0163163_10086383
204 Ga0157379_10174758
205 Ga0157379_10202986
206 Ga0157376_10165698
207 Ga0213872_10000954
208 Ga0213872_10004386
209 Ga0213872_10008894
210 Ga0213872_10080298
211 Ga0213872_10127140
212 Ga0213875_10000910
213 Ga0207697_10091962
214 Ga0207682_10130610
215 Ga0207684_10220901
216 Ga0207707_10080012
217 Ga0207695_10004246
218 Ga0207660_10238410
219 Ga0207646_10034103
220 Ga0207681_10251076
221 Ga0207664_10280922
222 Ga0207690_10092523
223 Ga0207709_10039680
224 Ga0207670_10005161
225 Ga0207670_10234901
226 Ga0207669_10132639
227 Ga0207711_10592224
228 Ga0207711_10682751
229 Ga0207667_11121485
230 Ga0207668_10331056
231 Ga0207677_11058293
232 Ga0207703_10348431
233 Ga0207641_10064763
234 Ga0207648_10505967
235 Ga0207648_11294996
236 Ga0207676_10013601
237 Ga0265326_10011680
238 Ga0265318_10049062
239 Ga0265338_10019227
240 Ga0265328_10000043
241 Ga0265340_10023363
242 Ga0265339_10237185
243 Ga0265331_10002771
244 Ga0265327_10007722
245 Ga0265327_10028530
246 Ga0265327_10133098
247 Ga0265316_10102518
248 Ga0316575_10047202
249 Ga0316579_10202610
250 Ga0265314_10284444
251 Ga0316576_10017505
252 Ga0316576_10201921
253 Ga0307414_10346299
254 Ga0373954_0389307
255 Ga0373955_0111520
256 Ga0373931_0040716
257 Ga0373933_0062717
258 Ga0373947_0245698
259 Ga0373937_0026024
260 Ga0373937_0052643
261 Ga0316582_0127943
262 Ga0373925_0863090
263 Ga0436364_0449559
264 Ga0436364_0611833
265 Ga0436364_1335081
266 Ga0436360_0140719
267 Ga0436360_1123045
268 Ga0436361_0151690
269 Ga0436361_0250339
270 Ga0436361_0292589
271 Ga0436361_0421456
272 Ga0436361_0444089
273 Ga0436361_0712546
274 Ga0436361_0742943
275 Ga0436361_0977388
276 Ga0436363_1558956
277 Ga0436362_0110435
278 Ga0451791_1061556
279 Ga0451807_1085638
280 Ga0439445_0079450
281 Ga0466972_0000029
282 Ga0466965_0065435
283 Ga0466961_0186745
284 Ga0466971_0033445
285 Ga0466957_0004713
286 Ga0466959_0310591
287 Ga0466958_0000283
288 Ga0466967_0257495
289 Ga0495592_0023549
290 Ga0495629_0545154
291 Ga0495639_0067434
292 Ga0495586_0160303
293 Ga0495667_0235314
294 Ga0495634_0089023
295 Ga0495657_0118241
296 Ga0495599_0054960
297 Ga0495680_0017310
298 Ga0496108_0619253
299 Ga0496109_0037157
300 Ga0496110_0886088
301 Ga0501067_0215625
302 Ga0501070_0107876
303 Ga0501080_0064651
304 Ga0501080_0570798
305 nmdc:mga0qj67_144565_c1
306 nmdc:mga0n895_28859_c1
307 nmdc:mga0rr50_532249_c1
308 Ga0495601_0123261
309 Ga0495619_0007198
310 Ga0500641_0002840
311 Ga0590071_060505
312 Ga0590075_018048
313 Ga0501082_0047805
314 Ga0466962_0007675

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

39

212

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7pvi-assembly1.cif.gz_BBB dtdp-sugar epimerase 0.9721 2 186
2ixk-assembly1.cif.gz_B rmlc p aeruginosa with dtdp-4-keto rhamnnose (the product of the reaction) 0.9706 2 178
3ryk-assembly1.cif.gz_B 1.63 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase (rfbc) from bacillus anthracis str. ames with tdp and ppi bound 0.969 2 175
2ixh-assembly1.cif.gz_A rmlc p aeruginosa with dtdp-rhamnose 0.9688 1 180
5buv-assembly2.cif.gz_B-2 x-ray structure of wbca from yersinia enterocolitica 0.9606 2 175
ID Description Score Start End Superfamily
5buvB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9606 2 175 2.60.120.10
6dinA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9541 2 180 2.60.120.10
2b9uD00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9524 2 178 2.60.120.10
1epzA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9429 2 178 2.60.120.10
2ixcB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9411 1 178 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A1I4U8X5-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9944 2 183 GO:0000271
GO:0005829
GO:0008830
GO:0019305
AF-K2LDA2-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9917 1 177 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A4Q0M283-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9917 1 130 GO:0000271
GO:0005829
GO:0008830
GO:0019305
AF-A0A3M0XTN2-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9901 56 179 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A7X0CZE8-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9898 1 185 GO:0005829
GO:0008830
GO:0019305
GO:0045226

Map